DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and Dscam1

DIOPT Version :10

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster


Alignment Length:365 Identity:65/365 - (17%)
Similarity:107/365 - (29%) Gaps:157/365 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLLFGSIATVRGRAVDLVDDSNDVDNSIEAEEEKPRNRAFEADWLKFTKTPPTKLQQADGATIEI 78
            |:||.::|.:...:..|      ..|..:|:::.|          .|.|.|..::..::....||
  Fly    11 LMLFAAVALIACGSQTL------AANPPDADQKGP----------VFLKEPTNRIDFSNSTGAEI 59

  Fly    79 VCEMMGSQVPSIQWV------VGHLPRSELDDLDSNQVAEEAPSAIVRVRSSHIIDHVLSEARTY 137
            .|:..|:.:|.|.|:      ||.:|       ...|::.:........|:......|  .|:.|
  Fly    60 ECKASGNPMPEIIWIRSDGTAVGDVP-------GLRQISSDGKLVFPPFRAEDYRQEV--HAQVY 115

  Fly   138 TCVGRTG-----SKTIYASTVV--------------------------------------HPPRS 159
            .|:.|..     |:.::...||                                      |....
  Fly   116 ACLARNQFGSIISRDVHVRAVVSQHYEEDIHKAFVIRGNSAILKCDIPSFVADFVNVISWHSDEK 180

  Fly   160 SRLTPEKTYPG---------------------------------------AQKPRIIYTE----- 180
            ....|...|.|                                       |.|.|::.||     
  Fly   181 ENFYPGTEYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVGSV 245

  Fly   181 ---------KTHLDL-----MGSNIQLPCRVHARPRAEITW--------------LNNENKEIVQ 217
                     :.|:.|     ||| :.|.|...|.|.....|              ||:..|::  
  Fly   246 SPQLSGNGNQEHITLTRVPKMGS-VTLMCPAQAYPVPFFRWYKFIEGTTRKQAVVLNDRVKQV-- 307

  Fly   218 GHRHRVLANGDLLISEIKWEDMGNYKCIARNVVGKDTADT 257
                    :|.|:|.:...||.|.|.|:..|.||.::.:|
  Fly   308 --------SGTLIIKDAVVEDSGKYLCVVNNSVGGESVET 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 PHA02785 <74..246 CDD:165149 50/292 (17%)
Ig_3 173..248 CDD:464046 25/107 (23%)
Dscam1NP_001246162.1 IgI_1_Dscam 38..136 CDD:409547 22/116 (19%)
Ig strand A 39..42 CDD:409547 1/12 (8%)
Ig strand A' 48..52 CDD:409547 0/3 (0%)
Ig strand B 55..64 CDD:409547 3/8 (38%)
Ig strand C 70..76 CDD:409547 2/5 (40%)
Ig strand C' 78..81 CDD:409547 0/2 (0%)
Ig strand D 87..90 CDD:409547 0/2 (0%)
Ig strand E 95..100 CDD:409547 0/4 (0%)
Ig strand F 113..121 CDD:409547 2/7 (29%)
Ig strand G 124..136 CDD:409547 1/11 (9%)
IgI_2_Dscam 246..343 CDD:409545 25/105 (24%)
Ig strand A 247..250 CDD:409545 0/2 (0%)
Ig strand A' 260..264 CDD:409545 1/3 (33%)
Ig strand B 267..274 CDD:409545 3/7 (43%)
Ig strand C 282..288 CDD:409545 1/5 (20%)
Ig strand C' 294..297 CDD:409545 0/2 (0%)
Ig strand D 303..307 CDD:409545 1/3 (33%)
Ig strand E 309..315 CDD:409545 3/5 (60%)
Ig strand F 322..330 CDD:409545 3/7 (43%)
Ig strand G 333..343 CDD:409545 2/7 (29%)
IgC2_3_Dscam 346..426 CDD:409549
Ig strand A 347..352 CDD:409549
Ig strand A' 355..359 CDD:409549
Ig strand B 362..372 CDD:409549
Ig strand C 377..383 CDD:409549
Ig strand C' 384..387 CDD:409549
Ig strand E 392..398 CDD:409549
Ig strand F 405..413 CDD:409549
Ig strand G 416..426 CDD:409549
IgI_4_Dscam 432..527 CDD:409548
Ig strand A 432..435 CDD:409548
Ig strand A' 441..445 CDD:409548
Ig strand B 448..457 CDD:409548
Ig strand C 462..468 CDD:409548
Ig strand C' 470..473 CDD:409548
Ig strand D 478..486 CDD:409548
Ig strand E 490..499 CDD:409548
Ig strand F 506..514 CDD:409548
Ig strand G 517..527 CDD:409548
IgI_5_Dscam 531..618 CDD:409550
Ig strand A 531..533 CDD:409550
Ig strand A' 538..542 CDD:409550
Ig strand B 545..552 CDD:409550
Ig strand C 559..565 CDD:409550
Ig strand C' 566..568 CDD:409550
Ig strand D 575..579 CDD:409550
Ig strand E 582..588 CDD:409550
Ig strand F 596..604 CDD:409550
Ig strand G 608..618 CDD:409550
Ig 621..718 CDD:472250
Ig strand B 639..643 CDD:409353
Ig strand C 653..657 CDD:409353
Ig strand E 684..688 CDD:409353
Ig strand F 698..703 CDD:409353
Ig strand G 711..714 CDD:409353
IgI_7_Dscam 721..815 CDD:409546
Ig strand A 721..725 CDD:409546
Ig strand A' 730..734 CDD:409546
Ig strand B 737..746 CDD:409546
Ig strand C 752..758 CDD:409546
Ig strand C' 764..767 CDD:409546
Ig strand D 775..778 CDD:409546
Ig strand E 780..786 CDD:409546
Ig strand F 793..801 CDD:409546
Ig strand G 806..815 CDD:409546
Ig 818..916 CDD:472250
Ig strand B 836..840 CDD:409353
Ig strand C 849..853 CDD:409353
Ig strand E 880..884 CDD:409353
Ig strand F 894..899 CDD:409353
FN3 <899..1212 CDD:442628
Ig strand G 907..910 CDD:409353
FN3 1222..1312 CDD:238020
Ig <1339..1406 CDD:472250
Ig strand C 1350..1354 CDD:409358
Ig strand E 1372..1376 CDD:409358
Ig strand F 1386..1391 CDD:409358
Ig strand G 1399..1402 CDD:409358
FN3 1409..1499 CDD:238020
FN3 1504..1584 CDD:238020
Dscam_C 1893..2008 CDD:463546
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.