| Sequence 1: | NP_728961.2 | Gene: | ImpL2 / 38513 | FlyBaseID: | FBgn0001257 | Length: | 267 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001246162.1 | Gene: | Dscam1 / 35652 | FlyBaseID: | FBgn0033159 | Length: | 2038 | Species: | Drosophila melanogaster |
| Alignment Length: | 365 | Identity: | 65/365 - (17%) |
|---|---|---|---|
| Similarity: | 107/365 - (29%) | Gaps: | 157/365 - (43%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 14 LLLFGSIATVRGRAVDLVDDSNDVDNSIEAEEEKPRNRAFEADWLKFTKTPPTKLQQADGATIEI 78
Fly 79 VCEMMGSQVPSIQWV------VGHLPRSELDDLDSNQVAEEAPSAIVRVRSSHIIDHVLSEARTY 137
Fly 138 TCVGRTG-----SKTIYASTVV--------------------------------------HPPRS 159
Fly 160 SRLTPEKTYPG---------------------------------------AQKPRIIYTE----- 180
Fly 181 ---------KTHLDL-----MGSNIQLPCRVHARPRAEITW--------------LNNENKEIVQ 217
Fly 218 GHRHRVLANGDLLISEIKWEDMGNYKCIARNVVGKDTADT 257 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ImpL2 | NP_728961.2 | IGc2 | 187..251 | CDD:197706 | 20/77 (26%) |
| Dscam1 | NP_001246162.1 | Ig | 38..130 | CDD:299845 | 22/110 (20%) |
| IG | 57..133 | CDD:214652 | 18/84 (21%) | ||
| IG_like | 267..343 | CDD:214653 | 22/84 (26%) | ||
| Ig | 269..340 | CDD:143165 | 20/81 (25%) | ||
| IG_like | 353..425 | CDD:214653 | |||
| IGc2 | 361..413 | CDD:197706 | |||
| I-set | 433..527 | CDD:254352 | |||
| IGc2 | 446..517 | CDD:197706 | |||
| I-set | 533..618 | CDD:254352 | |||
| IGc2 | 544..607 | CDD:197706 | |||
| Ig | 641..714 | CDD:143165 | |||
| IGc2 | 735..804 | CDD:197706 | |||
| I-set | 819..914 | CDD:254352 | |||
| Ig | 833..921 | CDD:299845 | |||
| FN3 | 918..1011 | CDD:238020 | |||
| FN3 | 1018..1116 | CDD:238020 | |||
| FN3 | 1124..1217 | CDD:238020 | |||
| FN3 | 1222..1312 | CDD:238020 | |||
| Ig | 1339..1406 | CDD:299845 | |||
| FN3 | 1409..1499 | CDD:238020 | |||
| FN3 | 1504..1584 | CDD:238020 | |||
| Dscam_C | 1890..2008 | CDD:289151 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||