DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and DIP-eta

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster


Alignment Length:221 Identity:54/221 - (24%)
Similarity:81/221 - (36%) Gaps:60/221 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 PP--------TKLQQADGATIEIVCEMMGSQVPSIQWVVGHLPRSELDDLDSNQVAEEAPS---- 116
            ||        |.:...:|:.:.:.|...||..|:|.|      |.|..........||..|    
  Fly   144 PPDILDYPTSTDMVVREGSNVTLKCAATGSPEPTITW------RRESGVPIELATGEEVMSIEGT 202

  Fly   117 --AIVRVRSSHIIDHVLSEARTYTCVGRTGSKTIYASTVVHPPRSSRLTPEKTYPGAQKPRIIYT 179
              .|..||..|:        ..|.|:         ||..|.|..|.|:|....:|    |.|...
  Fly   203 DLVIPNVRRHHM--------GAYLCI---------ASNGVPPSVSKRITLVVHFP----PMITVQ 246

  Fly   180 EKTHLDLMGSNIQLPCRVHARPRAEITWLNNENKEIVQ-------------GHRHRVLANGDLLI 231
            .:....:.|..:.|.|...|.|:: |.:...|..|||.             |:|:.:    .|.|
  Fly   247 NQLIGAVEGKGVTLDCESEAYPKS-INYWTRERGEIVPPGGKYSANVTEIGGYRNSM----RLHI 306

  Fly   232 SEIKWEDMGNYKCIARNVVGKDTADT 257
            :.:...:.|:|:|:|:|.:| ||..|
  Fly   307 NPLTQAEFGSYRCVAKNSLG-DTDGT 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 19/76 (25%)
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845
IG_like 51..137 CDD:214653
IG_like 153..237 CDD:214653 26/106 (25%)
Ig 161..224 CDD:299845 20/85 (24%)
IG_like 252..335 CDD:214653 23/86 (27%)
Ig 258..333 CDD:143165 22/80 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.