DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and bdl

DIOPT Version :10

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster


Alignment Length:208 Identity:48/208 - (23%)
Similarity:72/208 - (34%) Gaps:62/208 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 FTKTPPTKLQQADGATIEIVCEMMGSQVPSIQWVVGHLPRSELDDL--DSNQVAEEAPSAIVRVR 122
            |...||.|                     :::|        |.|.|  ||..|    |....::.
  Fly   269 FRANPPLK---------------------NLRW--------EKDGLLFDSYNV----PGVFYKMN 300

  Fly   123 SSHIIDHV-LSEARTYTC-----VGRTGSKTIYASTVVHPPRSSRLTPEKTYPGAQKPRIIYTEK 181
            .|.....| .:.|.:|||     :|..|...:.:..|:.||..|           ..|:.||.:|
  Fly   301 GSLFFAKVDENHAGSYTCTPYNDLGTDGPSPVISVIVLRPPIFS-----------VTPKAIYIQK 354

  Fly   182 THLDLMGSNIQLPCRVHARP---RAEITWLNNENKEIVQGHRHRVLANGDLLISEIKWEDMGNYK 243
                 :|...:|||....|.   |..|.|...:.:.:......  |:.|:|.|:.:...|.|.|:
  Fly   355 -----LGEAAELPCEAIDRDGNNRPSIIWGRKDGQPLPADRFS--LSGGNLTITGLVEGDRGIYE 412

  Fly   244 CIARNVVGKDTAD 256
            |.|.|.....||:
  Fly   413 CSATNEAATITAE 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 PHA02785 <74..246 CDD:165149 40/182 (22%)
Ig_3 173..248 CDD:464046 21/77 (27%)
bdlNP_608822.1 IG_like 42..128 CDD:214653
Ig strand C 69..72 CDD:409512
Ig strand E 108..112 CDD:409512
Ig strand F 122..127 CDD:409512
Ig 153..242 CDD:472250
Ig strand B 168..172 CDD:409544
Ig strand C 181..185 CDD:409544
Ig strand E 207..211 CDD:409544
Ig strand F 221..226 CDD:409544
Ig strand G 235..238 CDD:409544
Ig_3 247..322 CDD:464046 18/85 (21%)
Ig 341..428 CDD:472250 26/103 (25%)
Ig strand B 359..363 CDD:409353 1/3 (33%)
Ig strand C 375..380 CDD:409353 2/4 (50%)
Ig strand E 396..400 CDD:409353 2/3 (67%)
Ig strand F 410..415 CDD:409353 2/4 (50%)
Ig strand G 423..426 CDD:409353 2/3 (67%)
FN3 435..524 CDD:238020
FN3 554..636 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.