DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and CG33543

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster


Alignment Length:278 Identity:58/278 - (20%)
Similarity:102/278 - (36%) Gaps:68/278 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VCALALLLFGSIATVRGRAVDLVDDSNDVDNSIEAEEEKPRNRAFEADWLKFTKTPPTKLQQADG 73
            :|:|.|||....|.:.|:   |...|:....:..|..::|             .|||..||.:..
  Fly     7 LCSLLLLLLSQNAAILGQ---LDSTSSGGSGTGGAPPDRP-------------PTPPLSLQPSTP 55

  Fly    74 ATIEIV-------CEMMGSQVPSIQWVVGHLPRSELDDLDSNQV-AEEAPSAIVRVRSSHIIDHV 130
            :....|       |:.:...:.: :|   ..||.:..:....:| .|:..:.::.:    :.:|:
  Fly    56 SITHFVNESFIIFCQTVQKDIDT-KW---RDPRGQTRENTKGRVHIEKKTTGLLAL----VFEHI 112

  Fly   131 LSEAR-TYTCV---GRTGSKTIYASTVVHPPRSSRLTPEKTYPGA------QKPRIIYTEKTHLD 185
            ..|.| .:||.   .|.|::.:              ..|:.:..:      ||.....||:....
  Fly   113 ALEDRGNWTCEVNGNRNGNRNV--------------NVEREFLASFELLVNQKISFGKTEQVQSV 163

  Fly   186 LMGSNIQLPCRVHARPRAEITWL-NNENKEIVQGHRHRVLANGDLLISEIKWEDMGNYKCIARNV 249
            ..|.:..:.|.|...|..|::|| |.|....|...:|..|:|| |.|..:...|.|.|.|.|..:
  Fly   164 REGRDAMVNCFVEGMPAPEVSWLYNGEYINTVNSTKHNRLSNG-LYIRNVSQADAGEYTCRAMRI 227

  Fly   250 VGKDTADTFVYPVLNEED 267
            .          |..::.|
  Fly   228 T----------PTFSDSD 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 21/64 (33%)
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 20/59 (34%)
IG_like 256..336 CDD:214653
IGc2 263..327 CDD:197706
FN3 341..445 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.