DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and dpr4

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster


Alignment Length:237 Identity:53/237 - (22%)
Similarity:85/237 - (35%) Gaps:67/237 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 CEMMGSQVPSIQWVVGHLPRSE--LDDLDSNQV-AEEAPSAIVRVRSSHIIDHVLSEAR------ 135
            |.|:|.:||...|   ..|.|:  .|:....:| |....:|::..|..::.|..:|..|      
  Fly    26 CGMVGGEVPPHYW---ETPYSQPYFDNSSRREVTATVGQAALLHCRVRNLGDRAVSWIRKRDLHI 87

  Fly   136 ------TYTCVGRTGSKTIYASTVVHPPRSSRLT-----PEKTYPG------AQKPRIIYTEKTH 183
                  |||...|..|        :|...|...|     |:....|      :.:|:|  ::...
  Fly    88 LTVGILTYTNDQRFQS--------LHSEGSDEWTLRISSPQPRDSGTYECQVSTEPKI--SQGFR 142

  Fly   184 LDLM----------------GSNIQLPCRVHAR--PRAEITW------LNNENKEIVQGHRHRVL 224
            |:::                ||:|.|.|.....  |.:.|.|      :|...:..:.....|..
  Fly   143 LNVVVSRAKILGNAELFIKSGSDINLTCLAMQSPVPPSFIYWYKGKRVMNYSQRGGINVITERST 207

  Fly   225 ANGDLLISEIKWEDMGNYKCIARNVVGKDTADTFVYPVLNEE 266
            ....|||::....|.|||.|   :....|:|...|: |:|.|
  Fly   208 RTSKLLIAKATPADSGNYTC---SPSSSDSASVVVH-VINGE 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 18/87 (21%)
dpr4NP_001014616.2 V-set 53..146 CDD:284989 20/102 (20%)
IG_like 53..145 CDD:214653 20/101 (20%)
ig 153..227 CDD:278476 17/73 (23%)
IG_like 161..>227 CDD:214653 17/65 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.