DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and DIP-beta

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster


Alignment Length:255 Identity:58/255 - (22%)
Similarity:93/255 - (36%) Gaps:80/255 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 TPPTKLQQA----------------------DGATIEIVCEMMGSQVPSIQWVVGHLPRSELDDL 105
            |.|.|:|.|                      :|.:.::||...|...|.|.|      |.|    
  Fly   195 TDPMKMQTATLEVVIPPDIINEETSGDMMVPEGGSAKLVCRARGHPKPKITW------RRE---- 249

  Fly   106 DSNQVAEEAPSAIVRVRSSHIIDHVL-------SEARTYTCVGRTGSKTIYASTVVHPPRSSRLT 163
            |..::.....|. .:.::..:...:|       ||...|.|:         ||..|.|..|.|:.
  Fly   250 DGREIIARNGSH-QKTKAQSVEGEMLTLSKITRSEMGAYMCI---------ASNGVPPTVSKRMK 304

  Fly   164 PE-KTYPGAQKPRIIYTEKTHLDLMG----SNIQLPCRVHARPRAEITWLNNENKEIVQGHRHRV 223
            .: ..:|..|.|.         .|:|    :::.|.|.|.|.|:|...|.....:.|:.|.|:.:
  Fly   305 LQVHFHPLVQVPN---------QLVGAPVLTDVTLICNVEASPKAINYWQRENGEMIIAGDRYAL 360

  Fly   224 LANGD--------LLISEIKWEDMGNYKCIARNVVGKDTADTF-VY-------PVLNEED 267
            ....:        |.|..::..|.|.||||::|.:| ||..|. :|       .:|.::|
  Fly   361 TEKENNMYAIEMILHIKRLQSSDFGGYKCISKNSIG-DTEGTIRLYEMERPGKKILRDDD 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 20/75 (27%)
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 5/13 (38%)
ig 102..195 CDD:278476 58/255 (23%)
IG_like 219..307 CDD:214653 22/107 (21%)
Ig 221..307 CDD:299845 22/105 (21%)
Ig 311..404 CDD:299845 28/102 (27%)
IG_like 327..405 CDD:214653 23/78 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.