| Sequence 1: | NP_728961.2 | Gene: | ImpL2 / 38513 | FlyBaseID: | FBgn0001257 | Length: | 267 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_808547.3 | Gene: | Sdk1 / 330222 | MGIID: | 2444413 | Length: | 2193 | Species: | Mus musculus |
| Alignment Length: | 254 | Identity: | 62/254 - (24%) |
|---|---|---|---|
| Similarity: | 93/254 - (36%) | Gaps: | 59/254 - (23%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 3 AKMNLHVCALALLLFGSIATVRGRAVDLVDDSNDVDNSIEAEEEKPRNRAF----EADWLKFTKT 63
Fly 64 PPTKLQQADGATIEIVCEMMGSQVPSIQWVVGHLPRSELDDLDSNQVAEEAPSAIVRVRSSHIID 128
Fly 129 HVLSEARTYTCVGRTGSKTIYASTVVHPPRSSRLTPEKTYPGAQKPRIIYTEKTHLDLMGSNIQL 193
Fly 194 PCRVHARPRAEITWLNNENKEIVQGH----RHRVLANGDLLISEIKWEDMGNYKCIARN 248 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ImpL2 | NP_728961.2 | IGc2 | 187..251 | CDD:197706 | 22/66 (33%) |
| Sdk1 | NP_808547.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..56 | ||
| Ig_2 | 94..169 | CDD:290606 | |||
| IG_like | 100..169 | CDD:214653 | |||
| IG_like | 183..263 | CDD:214653 | |||
| Ig | 197..247 | CDD:299845 | |||
| IG_like | 281..357 | CDD:214653 | 8/45 (18%) | ||
| IGc2 | 294..347 | CDD:197706 | 3/18 (17%) | ||
| I-set | 368..457 | CDD:254352 | 21/102 (21%) | ||
| Ig | 388..454 | CDD:143165 | 16/74 (22%) | ||
| I-set | 462..552 | CDD:254352 | 28/89 (31%) | ||
| Ig | 476..552 | CDD:299845 | 22/65 (34%) | ||
| I-set | 557..646 | CDD:254352 | |||
| Ig | 562..646 | CDD:299845 | |||
| FN3 | 650..741 | CDD:238020 | |||
| fn3 | 753..839 | CDD:278470 | |||
| FN3 | 854..949 | CDD:238020 | |||
| FN3 | 954..1036 | CDD:238020 | |||
| FN3 | 1052..1148 | CDD:238020 | |||
| FN3 | 1158..1253 | CDD:238020 | |||
| FN3 | 1261..1349 | CDD:238020 | |||
| FN3 | 1360..1453 | CDD:238020 | |||
| FN3 | 1459..1554 | CDD:238020 | |||
| FN3 | 1562..1676 | CDD:238020 | |||
| FN3 | 1686..1779 | CDD:238020 | |||
| FN3 | 1784..1865 | CDD:238020 | |||
| FN3 | 1885..1978 | CDD:238020 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 2057..2080 | ||||
| PDZ-binding. /evidence=ECO:0000250|UniProtKB:Q6V4S5 | 2187..2193 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||