DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and dpr18

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster


Alignment Length:265 Identity:54/265 - (20%)
Similarity:92/265 - (34%) Gaps:73/265 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 EKPRNR-AFEADWLKFTKTPPTKLQQADG--ATIEIVCE-MMGSQV-----PSIQWVVGHLPRSE 101
            |:||:: ..|..|..|.:.|.......|.  :.:.:..| ::..:|     .::.||     |..
  Fly   203 ERPRSKHHHEHHWGPFFEEPINSATSGDNLVSAVHLFTEAVLNCRVGMLKDKTVMWV-----RRT 262

  Fly   102 LDDLDSNQVAEEAPSAIVRVRSSH--------IIDHVLSE-ARTYTCVGRTGSKTIYAS--TVVH 155
            .:.:....|.....|...|:|...        :|:...:| |..|.|...|....::.:  ||:.
  Fly   263 AEKVSLLTVGNVTYSGDPRIRVKFQYPNNWRLLINPTQTEDAGVYMCQVSTHPPRVFTTNLTVLE 327

  Fly   156 PP-----RSSRLTPEKTYPGA--------------QKPR----------------IIYTEKTHLD 185
            ||     ...|...::.|...              ||.|                :|....:.|:
  Fly   328 PPLRIIDEHERDVGDRYYKSGSTVDLQCQISRSFFQKERQTILKSTDSANDAVQKLINETTSELN 392

  Fly   186 LMGSNIQLPCRVHARPRAE-----ITWLNNENKEIVQGHRHRVLANGD------LLISEIKWEDM 239
            |:|:..|...:...:...:     |||..:|  |.:||..:|.|:..|      :.|.:.|..|.
  Fly   393 LIGNVNQTQHKFSGQDLEKYFTKFITWAKDE--EPLQGMTNRRLSVSDVWLTSRISIGDAKLSDS 455

  Fly   240 GNYKC 244
            |||.|
  Fly   456 GNYSC 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 19/69 (28%)
dpr18NP_573102.1 IG_like 242..325 CDD:214653 14/87 (16%)
Ig <258..326 CDD:299845 14/72 (19%)
IGc2 <417..461 CDD:197706 17/46 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.