DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and dpr8

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster


Alignment Length:234 Identity:51/234 - (21%)
Similarity:83/234 - (35%) Gaps:61/234 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 NRAFEADWLKFTKTPPTKLQQAD-----------GATIEIVCEMMGSQVPSIQWV---------V 94
            ::.|..|:|:...||.|.....|           |.|:::.|.:......::.||         |
  Fly    23 SKRFFTDFLQDLPTPGTGGPTFDTTIGTNITGLVGKTVKLTCRVKNLGNRTVSWVRHRDIHLLTV 87

  Fly    95 GHLPRSELDDLDSNQVAEEAPSA---IVRVRSSHIIDHVLSEARTYTC--VGRTGSKTIYASTVV 154
            |....:.    |....|..:|.|   .:|:|.:...|..:.|.:..|.  :|.    ::|.: :|
  Fly    88 GRYTYTS----DQRFEAMHSPHAEDWTLRIRYAQRKDSGIYECQISTTPPIGH----SVYLN-IV 143

  Fly   155 HPPRSSRLTPEKTYPGAQKPRIIYTEKTHLDLMGSNIQLPCRVHARPRAEITWLNNENKEIVQGH 219
            .|...                ||...:.|:: .||.|.|.|.|...|....|.:.:.|:||:...
  Fly   144 EPVTD----------------IIGGPELHIN-RGSTINLTCIVKFAPEPPPTVIWSHNREIINFD 191

  Fly   220 RHR----------VLANGDLLISEIKWEDMGNYKCIARN 248
            ..|          ||....||:.:...:|.|.|.|...|
  Fly   192 SPRGGISLVTEKGVLTTSRLLVQKAITQDSGLYTCTPSN 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 21/72 (29%)
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 15/83 (18%)
V-set 52..143 CDD:284989 18/99 (18%)
IG_like 153..238 CDD:214653 22/79 (28%)
ig 153..232 CDD:278476 22/79 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.