| Sequence 1: | NP_728961.2 | Gene: | ImpL2 / 38513 | FlyBaseID: | FBgn0001257 | Length: | 267 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_036019026.1 | Gene: | Negr1 / 320840 | MGIID: | 2444846 | Length: | 362 | Species: | Mus musculus |
| Alignment Length: | 264 | Identity: | 50/264 - (18%) |
|---|---|---|---|
| Similarity: | 85/264 - (32%) | Gaps: | 74/264 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 19 SIATVRGR-------AVDLVDDSNDVDNSIEAEEEKPRNRAFEADWLKFTKTPPTKLQQA----- 71
Fly 72 --DGATIEIVCEMMGSQVPSIQWVVGHLPRSELDDLDSNQVAEEAPSAIVRVRSSHIIDHVLS-- 132
Fly 133 EARTYTCVGRTGSKTIYASTVVHPPRSSRLTPEKTYPGAQKPRIIYTEKTHLDLMGSNIQLP--- 194
Fly 195 ----CRVHARPRAEITWLNNENKEIVQGHRHRVLAN----GDLLISEIKWEDMGNYKCIARNVVG 251
Fly 252 KDTA 255 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ImpL2 | NP_728961.2 | IGc2 | 187..251 | CDD:197706 | 17/74 (23%) |
| Negr1 | XP_036019026.1 | FR1 | 38..55 | CDD:409353 | |
| Ig strand A' | 40..46 | CDD:409353 | |||
| IG_like | 41..129 | CDD:214653 | 11/49 (22%) | ||
| Ig strand B | 48..56 | CDD:409353 | |||
| CDR1 | 56..60 | CDD:409353 | |||
| FR2 | 61..68 | CDD:409353 | |||
| Ig strand C | 61..67 | CDD:409353 | |||
| CDR2 | 69..79 | CDD:409353 | |||
| Ig strand C' | 71..74 | CDD:409353 | |||
| Ig strand C' | 76..79 | CDD:409353 | |||
| FR3 | 80..115 | CDD:409353 | 9/29 (31%) | ||
| Ig strand D | 84..91 | CDD:409353 | 3/4 (75%) | ||
| Ig strand E | 94..100 | CDD:409353 | 0/5 (0%) | ||
| Ig strand F | 107..115 | CDD:409353 | 2/8 (25%) | ||
| CDR3 | 116..120 | CDD:409353 | 0/4 (0%) | ||
| Ig strand G | 120..129 | CDD:409353 | 2/13 (15%) | ||
| FR4 | 122..129 | CDD:409353 | 0/11 (0%) | ||
| Ig strand A' | 139..144 | CDD:409353 | 0/4 (0%) | ||
| IGc2 | 146..204 | CDD:197706 | 13/96 (14%) | ||
| Ig strand B | 150..157 | CDD:409353 | 1/6 (17%) | ||
| Ig strand C | 163..168 | CDD:409353 | 2/6 (33%) | ||
| Ig strand C' | 170..172 | CDD:409353 | 0/1 (0%) | ||
| Ig strand E | 180..186 | CDD:409353 | 0/5 (0%) | ||
| Ig strand F | 193..200 | CDD:409353 | 2/6 (33%) | ||
| Ig_3 | 219..295 | CDD:404760 | 16/76 (21%) | ||
| putative Ig strand A | 219..225 | CDD:409353 | 0/5 (0%) | ||
| Ig strand B | 235..239 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 248..252 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 274..278 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 288..293 | CDD:409353 | 3/4 (75%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||