DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and dpr14

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster


Alignment Length:316 Identity:69/316 - (21%)
Similarity:104/316 - (32%) Gaps:119/316 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GSIATV--RGRAVDLVDDSNDVDNSIEAEEEKPRNRAFEADWLKFTKT-----------PPTKLQ 69
            ||.:|.  |.||.|..|   ....:...|...|.....|.:.|:.|:|           |.|.|.
  Fly    22 GSTSTTLKRPRAGDPFD---TFPKNFWQEFSSPFTDTPEDEELEVTETTTHEPFPFFADPYTTLN 83

  Fly    70 QAD--GATIEIVCEMMGSQVPSIQWVVGHLPRSELDDL------------DSNQVAE-EAPS--- 116
            .:.  .:::.:.|.:...|..::.|:     |...|||            ||....| |.|:   
  Fly    84 ISTQLSSSVYLHCRVNDLQGKTVSWM-----RRRGDDLTLITFGQHTYSGDSRYSLEFEEPNDWK 143

  Fly   117 AIVRVRSSHIIDHVLSEARTYTCVGRTGSKTIYASTVVHPP-------------------RSSRL 162
            .:::..:..       :...|.|           ....|||                   |.| .
  Fly   144 LLIQFANER-------DEGPYEC-----------QVSSHPPLVLLVYLTIIVPHVEILDERGS-A 189

  Fly   163 TPEKTYPGAQKPRIIYTEKTHLDLMGSNIQLPCRVH--ARPRAEITW------LNNENK------ 213
            ||||.|..                 ||.|:|.|.:.  ..|.:.|||      ||.:..      
  Fly   190 TPEKYYKA-----------------GSTIELQCVISKIPHPSSYITWRHGPRLLNYDTSRGGISV 237

  Fly   214 --EIVQGHRHRVLANGDLLISEIKWEDMGNYKCIARNVVGKDTADTFVYPVLNEED 267
              :::.|   |.|:.  |.|:....:|.|||.|    ::|.:..:|.|..|||.|:
  Fly   238 KTDMLPG---RALSR--LYIANANRQDTGNYTC----MLGNEITETVVVHVLNGEE 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 21/79 (27%)
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 14/102 (14%)
Ig 84..169 CDD:299845 17/107 (16%)
IG_like 191..279 CDD:214653 28/113 (25%)
Ig 201..274 CDD:143165 20/81 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.