| Sequence 1: | NP_728961.2 | Gene: | ImpL2 / 38513 | FlyBaseID: | FBgn0001257 | Length: | 267 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001101611.1 | Gene: | Dscaml1 / 315615 | RGDID: | 1304887 | Length: | 2111 | Species: | Rattus norvegicus |
| Alignment Length: | 198 | Identity: | 53/198 - (26%) |
|---|---|---|---|
| Similarity: | 72/198 - (36%) | Gaps: | 37/198 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 73 GATIEIVCEMMGSQVPSIQWVVGHLPRSELDDLDSNQVAEEAPSAIVRVRSSHIIDHVLSEARTY 137
Fly 138 TC-VGRT-GSKTIYASTVVHPPRSSRLTPEKTYPGAQKPRIIYTEKTHLDLMGSNIQLPCRVHAR 200
Fly 201 PRAEITWLNNENKEIV---QGHRHRVLANGDLLISEIKWEDMGNYKCIARNVVGKDTADTFVYPV 262
Fly 263 LNE 265 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ImpL2 | NP_728961.2 | IGc2 | 187..251 | CDD:197706 | 21/66 (32%) |
| Dscaml1 | NP_001101611.1 | IG | 101..173 | CDD:214652 | |
| IGc2 | 101..168 | CDD:197706 | |||
| Ig | 183..276 | CDD:299845 | |||
| IG_like | 195..276 | CDD:214653 | |||
| I-set | 291..369 | CDD:254352 | 20/82 (24%) | ||
| IGc2 | 298..359 | CDD:197706 | 18/72 (25%) | ||
| IGc2 | 386..447 | CDD:197706 | 20/62 (32%) | ||
| I-set | 466..560 | CDD:254352 | |||
| Ig | 466..556 | CDD:299845 | |||
| IGc2 | 577..635 | CDD:197706 | |||
| IG_like | 665..744 | CDD:214653 | |||
| Ig | 673..739 | CDD:143165 | |||
| I-set | 748..843 | CDD:254352 | |||
| Ig7_DSCAM | 765..843 | CDD:143211 | |||
| I-set | 849..942 | CDD:254352 | |||
| Ig | 861..949 | CDD:299845 | |||
| FN3 | 945..1039 | CDD:238020 | |||
| FN3 | 1046..1143 | CDD:238020 | |||
| fn3 | 1151..1237 | CDD:278470 | |||
| FN3 | 1249..1340 | CDD:238020 | |||
| IGc2 | 1364..1428 | CDD:197706 | |||
| FN3 | 1442..1532 | CDD:238020 | |||
| FN3 | 1546..1618 | CDD:238020 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||