| Sequence 1: | NP_728961.2 | Gene: | ImpL2 / 38513 | FlyBaseID: | FBgn0001257 | Length: | 267 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_038937320.1 | Gene: | Kirrel3 / 315546 | RGDID: | 1311382 | Length: | 869 | Species: | Rattus norvegicus |
| Alignment Length: | 289 | Identity: | 53/289 - (18%) |
|---|---|---|---|
| Similarity: | 97/289 - (33%) | Gaps: | 95/289 - (32%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 14 LLLFGSIATVRGRAVDLVDDSNDVDNSIEAEEEKPRNRAFEADWLKFTKTPPTKLQQADGATI-- 76
Fly 77 --------------------------EIVCEMMGSQVP-----SIQWVVGHLPRSEL-------- 102
Fly 103 -DDLDSNQVAEEAPSAIVRVRSSHIIDHVLSEARTYTCVGRTGSKTIYASTVVHPPRSSRLTPEK 166
Fly 167 T--------------YPGAQKPRIIYTEKTHLDLMGSNIQLPCRVHARPRAEITWLNNENKEIVQ 217
Fly 218 GHRHRVLANGDLLISEIKWEDMGNYKCIA 246 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ImpL2 | NP_728961.2 | IGc2 | 187..251 | CDD:197706 | 13/60 (22%) |
| Kirrel3 | XP_038937320.1 | IG_like | 54..143 | CDD:214653 | |
| Ig strand A' | 56..60 | CDD:409353 | |||
| Ig strand B | 64..71 | CDD:409353 | |||
| Ig strand C | 78..82 | CDD:409353 | |||
| Ig strand C' | 84..87 | CDD:409353 | |||
| Ig strand D | 97..101 | CDD:409353 | |||
| Ig strand E | 104..116 | CDD:409353 | |||
| Ig strand G | 132..143 | CDD:409353 | |||
| IgI_2_KIRREL3-like | 149..246 | CDD:409416 | 18/112 (16%) | ||
| Ig strand B | 166..170 | CDD:409416 | 0/3 (0%) | ||
| Ig strand C | 180..184 | CDD:409416 | 0/3 (0%) | ||
| Ig strand E | 210..214 | CDD:409416 | 0/3 (0%) | ||
| Ig strand F | 224..229 | CDD:409416 | 3/4 (75%) | ||
| Ig strand G | 239..242 | CDD:409416 | 0/2 (0%) | ||
| Ig | <267..334 | CDD:416386 | 14/77 (18%) | ||
| Ig strand B | 267..274 | CDD:409353 | 0/6 (0%) | ||
| Ig strand C | 279..286 | CDD:409353 | 1/6 (17%) | ||
| Ig strand C' | 288..291 | CDD:409353 | 1/2 (50%) | ||
| Ig strand D | 298..302 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 304..310 | CDD:409353 | 0/5 (0%) | ||
| Ig strand G | 321..334 | CDD:409353 | 1/12 (8%) | ||
| Ig | 335..416 | CDD:416386 | 16/73 (22%) | ||
| Ig strand A' | 343..347 | CDD:409353 | 1/3 (33%) | ||
| Ig strand B | 350..360 | CDD:409353 | 2/9 (22%) | ||
| Ig strand C | 365..371 | CDD:409353 | 2/5 (40%) | ||
| Ig strand E | 381..387 | CDD:409353 | 1/12 (8%) | ||
| IgI_5_KIRREL3 | 418..515 | CDD:409479 | |||
| Ig strand B | 436..440 | CDD:409479 | |||
| Ig strand C | 450..454 | CDD:409479 | |||
| Ig strand E | 481..485 | CDD:409479 | |||
| Ig strand F | 496..501 | CDD:409479 | |||
| Ig strand G | 509..512 | CDD:409479 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||