Sequence 1: | NP_728961.2 | Gene: | ImpL2 / 38513 | FlyBaseID: | FBgn0001257 | Length: | 267 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001363879.1 | Gene: | Igsf9b / 315510 | RGDID: | 1564717 | Length: | 1441 | Species: | Rattus norvegicus |
Alignment Length: | 218 | Identity: | 59/218 - (27%) |
---|---|---|---|
Similarity: | 87/218 - (39%) | Gaps: | 42/218 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 60 FTKTPPTKLQQADGATIEIVCEMMGSQVPSIQWV-VGHLPRSELDDLDSNQVAEEAPSAIVRVRS 123
Fly 124 SHIIDHVLSEAR-TYTCVGRTGSKTIYASTVVHPPRSSRLTPEKTYPGAQKPRIIYTEKTHLDL- 186
Fly 187 MGSNIQLPCRVHARP-RAEITWLNNENKEIVQGH---RHRVLANGDLLISEIKWEDMGNYKCIAR 247
Fly 248 NVVGKDTAD----TFVYP--VLN 264 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ImpL2 | NP_728961.2 | IGc2 | 187..251 | CDD:197706 | 21/67 (31%) |
Igsf9b | NP_001363879.1 | PHA03247 | <898..1246 | CDD:223021 | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 918..1044 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1111..1332 | ||||
Ig | 41..115 | CDD:319273 | |||
I-set | 139..225 | CDD:369462 | 28/112 (25%) | ||
Ig | 229..321 | CDD:386229 | 23/91 (25%) | ||
Ig | <353..414 | CDD:386229 | |||
Ig | 438..502 | CDD:319273 | |||
FN3 | 510..605 | CDD:238020 | |||
FN3 | 621..703 | CDD:238020 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 762..821 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |