DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and Igsf9b

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001363879.1 Gene:Igsf9b / 315510 RGDID:1564717 Length:1441 Species:Rattus norvegicus


Alignment Length:218 Identity:59/218 - (27%)
Similarity:87/218 - (39%) Gaps:42/218 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 FTKTPPTKLQQADGATIEIVCEMMGSQVPSIQWV-VGHLPRSELDDLDSNQVAEEAPSAIVRVRS 123
            ||:|||..::..:|.:|.:.|...|:..|.:.|: .|.|    |......||::          .
  Rat   141 FTETPPQYIEAKEGGSITMTCTAFGNPKPIVTWLKEGTL----LSASGKYQVSD----------G 191

  Fly   124 SHIIDHVLSEAR-TYTCVGRTGSKTIYASTVVHPPRSSRLTPEKTYPGAQKPRIIYTEKTHLDL- 186
            |..:..|..|.| .|||  |..|   .....||          .|:...|.|..|.:...::.: 
  Rat   192 SLTVTSVSREDRGAYTC--RAYS---IQGEAVH----------TTHLLVQGPPFIVSPPENITVN 241

  Fly   187 MGSNIQLPCRVHARP-RAEITWLNNENKEIVQGH---RHRVLANGDLLISEIKWEDMGNYKCIAR 247
            :..:..|.||..|.| ....||...:.....|..   |.|:|.:|.|:|..:|.||.|.|.|:..
  Rat   242 ISQDALLTCRAEAYPGNLTYTWYWQDENVYFQNDLKLRVRILIDGTLIIFRVKPEDAGKYTCVPS 306

  Fly   248 NVVGKDTAD----TFVYP--VLN 264
            |.:|:..:.    |..||  |||
  Rat   307 NSLGRSPSASAYLTVQYPARVLN 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 21/67 (31%)
Igsf9bNP_001363879.1 PHA03247 <898..1246 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 918..1044
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1111..1332
Ig 41..115 CDD:319273
I-set 139..225 CDD:369462 28/112 (25%)
Ig 229..321 CDD:386229 23/91 (25%)
Ig <353..414 CDD:386229
Ig 438..502 CDD:319273
FN3 510..605 CDD:238020
FN3 621..703 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 762..821
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.