DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and ncam1a

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_009293555.1 Gene:ncam1a / 30447 ZFINID:ZDB-GENE-990415-31 Length:1010 Species:Danio rerio


Alignment Length:221 Identity:53/221 - (23%)
Similarity:85/221 - (38%) Gaps:50/221 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 LKFTKTP-PTKLQQADGATIEIVCEMMGSQVPSIQWVVGHL---PRSE--LDDLDSNQVAEEAPS 116
            |.|...| |.:..:.|.|  :|:|:::.|..|:|.|....:   |.::  |..|.:|.       
Zfish   115 LTFQYAPSPQEFNEGDDA--DIICDVISSPPPTIIWRYKKMRIQPETDVRLKVLSNNH------- 170

  Fly   117 AIVRVRSSHIIDHVLSEARTYTCVGRTGS------KTIYASTVVHPPRSSRLTPEKTYPGAQKPR 175
              :::|.....|.     ..|||.||..:      :.|.....|.|...:|              
Zfish   171 --LQIRGIKKTDE-----GDYTCEGRIMARGEIDLRVIKVIVNVLPSIRTR-------------- 214

  Fly   176 IIYTEKTHLDLMGSNIQLPCRVHARPRAEITWLNNENKEIVQGHRHRVLANG-DLLISEIKWEDM 239
              |||......:...:.|.|.....|...:.|... |.|:....::.:..:| :|.|.::...|.
Zfish   215 --YTELNATADINQAVTLACHADGYPEPTVKWARG-NTELESDEKYSLNEDGSELTIKDVNKLDE 276

  Fly   240 GNYKCIARNVVGKD----TADTFVYP 261
            |:|||||||..|:.    |.:.||.|
Zfish   277 GDYKCIARNKAGERSEEVTLNVFVQP 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 18/64 (28%)
ncam1aXP_009293555.1 Ig 20..112 CDD:299845
I-set 21..111 CDD:254352
IG_like 121..200 CDD:214653 21/94 (22%)
IGc2 128..189 CDD:197706 17/76 (22%)
Ig 208..301 CDD:299845 26/109 (24%)
IG_like 219..298 CDD:214653 20/79 (25%)
Ig 300..406 CDD:299845 2/3 (67%)
IG_like 308..406 CDD:214653
ig 413..498 CDD:278476
IG_like 415..498 CDD:214653
fn3 505..589 CDD:278470
FN3 624..715 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.