DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and Lsamp

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_038944182.1 Gene:Lsamp / 29561 RGDID:71102 Length:378 Species:Rattus norvegicus


Alignment Length:280 Identity:66/280 - (23%)
Similarity:92/280 - (32%) Gaps:97/280 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AKMNLHVCALALLLFGSIATVRGRAVDLVDDSNDVDNSIEAEEEKPRNRAFEADWLKFTKTPPTK 67
            |::||           |..|:.|..|..||.:...||                          ..
  Rat    32 AEVNL-----------SPITIPGLPVRSVDFNRGTDN--------------------------IT 59

  Fly    68 LQQADGATIEIVCEMMGSQVPSIQWV-------VGH-----LPRSELDDLDSNQVAEEAPSAIVR 120
            ::|.|.|.:..|.|...|:|   .|:       .||     .||.||:       ...|....:|
  Rat    60 VRQGDTAILRCVVEDKNSKV---AWLNRSGIIFAGHDKWSLDPRVELE-------KRHALEYSLR 114

  Fly   121 VRSSHIIDHVLSEARTYTCVGRT--GSKTIYASTVVH-PPRSSRLTPEKTYPGAQKPRIIYTEKT 182
            ::...:.|.     .:|||..:|  ..||.....:|. ||:.|.::.:.|..             
  Rat   115 IQKVDVYDE-----GSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVN------------- 161

  Fly   183 HLDLMGSNIQLPCRVHARPRAEITW--LNNENKEIVQGHRHRVLANGDLLISEIKWEDMGNYKCI 245
                .|||:.|.|..:.||...|||  |....:|. :|....      |.|..|..|..|.|:|.
  Rat   162 ----EGSNVTLVCMANGRPEPVITWRHLTPLGREF-EGEEEY------LEILGITREQSGKYECK 215

  Fly   246 ARNVVG----KDTADTFVYP 261
            |.|.|.    |....|..||
  Rat   216 AANEVSSADVKQVKVTVNYP 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 22/65 (34%)
LsampXP_038944182.1 Ig 55..145 CDD:416386 25/130 (19%)
FR1 55..71 CDD:409353 5/41 (12%)
Ig strand A' 56..62 CDD:409353 2/31 (6%)
Ig strand B 64..72 CDD:409353 2/7 (29%)
CDR1 72..76 CDD:409353 1/3 (33%)
FR2 77..84 CDD:409353 3/9 (33%)
Ig strand C 77..83 CDD:409353 3/8 (38%)
CDR2 85..95 CDD:409353 2/9 (22%)
Ig strand C' 87..90 CDD:409353 0/2 (0%)
Ig strand C' 92..95 CDD:409353 1/2 (50%)
FR3 96..131 CDD:409353 10/46 (22%)
Ig strand D 100..107 CDD:409353 3/13 (23%)
Ig strand E 110..116 CDD:409353 1/5 (20%)
Ig strand F 123..131 CDD:409353 3/12 (25%)
CDR3 132..136 CDD:409353 1/3 (33%)
Ig strand G 136..145 CDD:409353 2/8 (25%)
FR4 138..145 CDD:409353 1/6 (17%)
Ig_3 148..218 CDD:404760 25/93 (27%)
Ig strand A' 155..160 CDD:409353 0/4 (0%)
Ig strand B 166..173 CDD:409353 2/6 (33%)
Ig strand C 179..184 CDD:409353 3/4 (75%)
Ig strand D 190..193 CDD:409353 1/3 (33%)
Ig strand E 197..203 CDD:409353 2/11 (18%)
Ig strand F 210..217 CDD:409353 3/6 (50%)
Ig strand G 224..232 CDD:409353 1/7 (14%)
Ig_3 235..311 CDD:404760 1/1 (100%)
Ig strand B 252..256 CDD:409353
Ig strand C 265..269 CDD:409353
Ig strand E 290..294 CDD:409353
Ig strand F 304..309 CDD:409353
Ig strand G 318..321 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.