DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and dpr9

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001287332.1 Gene:dpr9 / 2768670 FlyBaseID:FBgn0038282 Length:602 Species:Drosophila melanogaster


Alignment Length:260 Identity:56/260 - (21%)
Similarity:85/260 - (32%) Gaps:91/260 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 NSIEAEEEKPRNRAFEADWLKFTKTPPTKLQQADGATIEIVCEM--MGSQVPSIQ--WVVGHLPR 99
            |||:.||.:.....|:.   .|:|.....|    |.|..:.|.:  :|::...:|  ||      
  Fly   244 NSIDLEEARNAGPYFDK---AFSKNVTALL----GKTAYLNCRVKNLGNKTMLLQVSWV------ 295

  Fly   100 SELDDLDSNQVAEEAPSAIVRVRSSHIIDHVLSEAR-TYTCVGRTGSKTIYASTVVHPPRSSRLT 163
                                    .|...|:|:..| |||...|        ...:|.|::....
  Fly   296 ------------------------RHRDIHLLTVGRYTYTSDQR--------FRAIHQPQTEDWM 328

  Fly   164 PEKTYP-----GAQKPRIIYT----EKTHLDLM----------------GSNIQLPCRVH--ARP 201
            .:..||     |..:.::..|    ...||:::                ||.|.|.|.:.  ..|
  Fly   329 LQIKYPQHRDSGIYECQVSTTPHMSHYIHLNVVEPSTEIIGAPDLYIESGSTINLTCIIQNSPEP 393

  Fly   202 RAEITWLNNE---------NKEIVQGHRHRVLANGD-----LLISEIKWEDMGNYKCIARNVVGK 252
            .|.|.|.:|.         |.:..:|....|...||     |||...:..|.|:|:|...|...|
  Fly   394 PAYIFWNHNNAFPSHPQIINYDSPRGGVSVVTNKGDTTTSFLLIKSARPSDSGHYQCNPSNAKPK 458

  Fly   253  252
              Fly   459  458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 23/95 (24%)
dpr9NP_001287332.1 Ig 263..361 CDD:299845 25/139 (18%)
IG_like 263..360 CDD:214653 25/138 (18%)
IG_like 371..464 CDD:214653 24/88 (27%)
IGc2 377..456 CDD:197706 23/78 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.