DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and LRIT1

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_056428.1 Gene:LRIT1 / 26103 HGNCID:23404 Length:623 Species:Homo sapiens


Alignment Length:268 Identity:53/268 - (19%)
Similarity:86/268 - (32%) Gaps:85/268 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PRNRAFEADWLKFTKTPPTKLQQADGATIEIV-------------CEMMGSQ---VPS---IQWV 93
            |.||.....|......|..:|.......:..|             .::..:|   :|.   :.|.
Human   115 PGNRLAAFPWAALRDAPKLRLLDLQANRLSAVPAEAARFLENLTFLDLSSNQLMRLPQELIVSWA 179

  Fly    94 --------VGHLPRSELDDLDSNQVAEEAPSAIVRVRSSHIID-------HVLSEARTYTCVGRT 143
                    .||.||..|...|:....:.....:|     |::|       .:.:|.|   |..  
Human   180 HLETGIFPPGHHPRRVLGLQDNPWACDCRLYDLV-----HLLDGWAPNLAFIETELR---CAS-- 234

  Fly   144 GSKTIYASTVVHPPRS------SRLTPEK-----TYPGAQKPRIIYTEKTHLDLMGSNIQLPCRV 197
                         |||      |:|...|     .:||....|         .|:|....|.|..
Human   235 -------------PRSLAGVAFSQLELRKCQGPELHPGVASIR---------SLLGGTALLRCGA 277

  Fly   198 HARPRAEITWLNNENKEIVQGHRHR-VLANGD----LLISEIKWEDMGNYKCIARNVVGKDTADT 257
            ...|..|::| ...|...:.|..|: |.::|.    |.:..:...|.|:|.|.|:|.:|  .::|
Human   278 TGVPGPEMSW-RRANGRPLNGTVHQEVSSDGTSWTLLGLPAVSHLDSGDYICQAKNFLG--ASET 339

  Fly   258 FVYPVLNE 265
            .:..::.|
Human   340 VISLIVTE 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 18/68 (26%)
LRIT1NP_056428.1 LRR 1 60..81
leucine-rich repeat 61..84 CDD:275378
LRR_8 63..143 CDD:290566 6/27 (22%)
LRR 2 84..105
leucine-rich repeat 85..132 CDD:275378 4/16 (25%)
LRR 3 108..129 4/13 (31%)
LRR_8 131..202 CDD:290566 12/70 (17%)
LRR_4 131..171 CDD:289563 4/39 (10%)
LRR 4 132..153 2/20 (10%)
leucine-rich repeat 133..156 CDD:275378 2/22 (9%)
LRR 5 156..177 2/20 (10%)
leucine-rich repeat 157..180 CDD:275378 3/22 (14%)
leucine-rich repeat 181..205 CDD:275378 6/23 (26%)
TPKR_C2 201..>240 CDD:301599 9/61 (15%)
Ig 267..345 CDD:299845 20/80 (25%)
IG_like 267..345 CDD:214653 20/80 (25%)
FN3 431..498 CDD:214495
LRR 6. /evidence=ECO:0000305 571..594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.