DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and Lrit3

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001274153.1 Gene:Lrit3 / 242235 MGIID:2685267 Length:681 Species:Mus musculus


Alignment Length:316 Identity:57/316 - (18%)
Similarity:102/316 - (32%) Gaps:123/316 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NDVDNSIEAEEEKPRNRAFEADWLKFTKTPPTKLQQADG-----------------ATIEI---- 78
            ||:|.:     |.|.|...:...|:..||...:| .|:.                 |:||.    
Mouse    44 NDLDMN-----EVPANFPVDTSKLRIEKTVVRRL-PAEAFYYLVELQYLWLAYNSVASIETSSFY 102

  Fly    79 ------VCEMMGSQVPSIQWV-VGHLPRSELDDLDSNQVAEEAPSAIVRVRSSHIIDHVLSEART 136
                  ...:.|:.:.:..|| :..:|.....||.:|::| ..|:..||.            .|.
Mouse   103 NLRQLHELRLDGNSLTAFPWVSLLDMPHLRTLDLHNNRIA-SVPNEAVRY------------LRN 154

  Fly   137 YTCVGRTGSKTI---------YASTVVHPPRSSRLTPEKTYPGAQ-------------------- 172
            .||:..:.::..         ::...|.|.||....|.:...|.|                    
Mouse   155 LTCLDLSSNRLTTLPPDFLDSWSHLAVTPSRSPDFPPRRIILGLQDNPWFCDCHISKVIELSKVT 219

  Fly   173 ---------------------------------KPRIIYTEKTHLDLMGSNIQLPCRVHARPRAE 204
                                             ||.::.:.......:|||:.|.|.....|..:
Mouse   220 DHAVVLLDPLMVCSEPERFQGILFQRVELEKCLKPSVMMSATKITSALGSNVLLRCDAKGHPTPQ 284

  Fly   205 ITWLNNE----NKEIVQ-----GHRHRVLANGDLLISEIKWEDMGNYKCIARNVVG 251
            :||..::    |..::|     |.|..:::     ::.|..:|.|:|:|.|:|:.|
Mouse   285 LTWTRSDGSTVNYTVIQESPGEGIRWSIIS-----LTSISHKDAGDYRCKAKNLAG 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 19/72 (26%)
Lrit3NP_001274153.1 LRR 1. /evidence=ECO:0000255 56..79 5/23 (22%)
LRR_8 61..117 CDD:290566 9/56 (16%)
LRR 2. /evidence=ECO:0000255 80..103 3/22 (14%)
leucine-rich repeat 83..106 CDD:275378 3/22 (14%)
LRR 3. /evidence=ECO:0000255 104..128 3/23 (13%)
LRR_8 105..165 CDD:290566 14/72 (19%)
LRR_4 106..146 CDD:289563 8/40 (20%)
leucine-rich repeat 107..130 CDD:275378 3/22 (14%)
LRR_4 129..170 CDD:289563 11/53 (21%)
LRR 4. /evidence=ECO:0000255 129..151 7/22 (32%)
leucine-rich repeat 131..154 CDD:275378 7/35 (20%)
LRR 5. /evidence=ECO:0000255 152..175 3/22 (14%)
leucine-rich repeat 155..168 CDD:275378 2/12 (17%)
Ig 254..335 CDD:299845 20/85 (24%)
IG_like 263..339 CDD:214653 20/78 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 350..391
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 425..464
FN3 489..563 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.