| Sequence 1: | NP_728961.2 | Gene: | ImpL2 / 38513 | FlyBaseID: | FBgn0001257 | Length: | 267 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_666357.2 | Gene: | Lrit1 / 239037 | MGIID: | 2385320 | Length: | 624 | Species: | Mus musculus |
| Alignment Length: | 253 | Identity: | 54/253 - (21%) |
|---|---|---|---|
| Similarity: | 92/253 - (36%) | Gaps: | 54/253 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 48 PRNRAFEADWLKFTKTPPTKLQQADGATIEIVCEMMGSQVPSIQWVVGH-LPRSELDDLDSNQVA 111
Fly 112 EEAPSAIVRV---------RSSHIIDHVLS--------EARTYTCV----GRTGSKTIYASTVVH 155
Fly 156 --PPRS------SRLTPEKTYPGAQKPRIIYTEKTHLDLMGSNIQLPCRVHARPRAEITWLNNEN 212
Fly 213 KEIVQGHRHR-VLANGD----LLISEIKWEDMGNYKCIARNVVGKDTADTFVYPVLNE 265 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ImpL2 | NP_728961.2 | IGc2 | 187..251 | CDD:197706 | 19/68 (28%) |
| Lrit1 | NP_666357.2 | LRRNT | 23..61 | CDD:214470 | |
| LRR 1 | 60..81 | ||||
| LRR_8 | 63..143 | CDD:290566 | 7/38 (18%) | ||
| leucine-rich repeat | 64..84 | CDD:275378 | |||
| LRR 2 | 84..105 | ||||
| leucine-rich repeat | 85..132 | CDD:275378 | 5/16 (31%) | ||
| LRR 3 | 108..129 | 4/13 (31%) | |||
| LRR_8 | 131..>176 | CDD:290566 | 9/56 (16%) | ||
| LRR_4 | 131..172 | CDD:289563 | 8/52 (15%) | ||
| LRR 4 | 132..153 | 1/31 (3%) | |||
| leucine-rich repeat | 133..156 | CDD:275378 | 3/33 (9%) | ||
| LRR 5 | 156..177 | 5/21 (24%) | |||
| leucine-rich repeat | 157..180 | CDD:275378 | 6/23 (26%) | ||
| leucine-rich repeat | 181..205 | CDD:275378 | 3/23 (13%) | ||
| TPKR_C2 | 201..>241 | CDD:301599 | 9/39 (23%) | ||
| Ig | 258..346 | CDD:299845 | 21/90 (23%) | ||
| IG_like | 268..346 | CDD:214653 | 21/80 (26%) | ||
| FN3 | 432..502 | CDD:214495 | |||
| LRR 6 | 526..549 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||