Sequence 1: | NP_728961.2 | Gene: | ImpL2 / 38513 | FlyBaseID: | FBgn0001257 | Length: | 267 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001357916.1 | Gene: | Ptprq / 237523 | MGIID: | 1096349 | Length: | 2301 | Species: | Mus musculus |
Alignment Length: | 291 | Identity: | 56/291 - (19%) |
---|---|---|---|
Similarity: | 94/291 - (32%) | Gaps: | 98/291 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 ALLLFGSIATVRGRAVDLVDDSNDVDNSIEAEEEKPRNRAFEADWLKFTKTPP--TKLQQADGAT 75
Fly 76 IEIVCEMMGSQVPSIQWVVGHLPRSELDDLDSNQVAEEAPSAIVRVRSSHIIDHVLSEARTYTCV 140
Fly 141 ---------GRTGSKTIYA--STVVHPPRSSRLTPEKTYPG--AQKPRIIYTEKTHLDLMGSNIQ 192
Fly 193 LPCRVHARPRAEITWLNNENKEIVQGHRHRVLANGDLLISE---------IKW------------ 236
Fly 237 --EDMGNYKCIARN----------VVGKDTA 255 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ImpL2 | NP_728961.2 | IGc2 | 187..251 | CDD:197706 | 15/96 (16%) |
Ptprq | NP_001357916.1 | FN3 | 57..151 | CDD:238020 | |
FN3 | 308..393 | CDD:238020 | |||
fn3 | 399..>441 | CDD:365830 | |||
FN3 | 570..654 | CDD:238020 | |||
fn3 | 668..744 | CDD:365830 | |||
FN3 | 762..850 | CDD:238020 | |||
fn3 | 857..934 | CDD:365830 | |||
FN3 | 951..1049 | CDD:238020 | |||
FN3 | 1056..1137 | CDD:238020 | |||
FN3 | 1152..1233 | CDD:238020 | |||
FN3 | 1247..1337 | CDD:238020 | |||
FN3 | 1342..1421 | CDD:238020 | |||
FN3 | 1432..1535 | CDD:238020 | |||
FN3 | 1542..1638 | CDD:238020 | 3/26 (12%) | ||
FN3 | 1645..1734 | CDD:238020 | 26/121 (21%) | ||
UP_III_II | 1759..1928 | CDD:297589 | 19/110 (17%) | ||
R-PTPc-Q | 2033..2256 | CDD:350464 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |