DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and IGSF9B

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001264214.1 Gene:IGSF9B / 22997 HGNCID:32326 Length:1437 Species:Homo sapiens


Alignment Length:223 Identity:54/223 - (24%)
Similarity:85/223 - (38%) Gaps:52/223 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 FTKTPPTKLQQADGATIEIVCEMMGSQVPSIQW-----VVGHLPRSELDD--LDSNQVAEEAPSA 117
            ||:|||..::..:|.:|.:.|...|:..|.:.|     ::|...:.::.|  |....|:.|    
Human   141 FTETPPQYIEAKEGGSITMTCTAFGNPKPIVTWLKEGTLLGASGKYQVSDGSLTVTSVSRE---- 201

  Fly   118 IVRVRSSHIIDHVLSEARTYTCVGRTGSKTIYASTVVHPPRSSRLTPEKTYPGAQKPRIIYTEKT 182
                      |......|.|:..|.          .||          .|:...|.|..|.:...
Human   202 ----------DRGAYTCRAYSIQGE----------AVH----------TTHLLVQGPPFIVSPPE 236

  Fly   183 HLDL-MGSNIQLPCRVHARP-RAEITWLNNENKEIVQGH---RHRVLANGDLLISEIKWEDMGNY 242
            ::.: :..:..|.||..|.| ....||...:.....|..   |.|:|.:|.|:|..:|.||.|.|
Human   237 NITVNISQDALLTCRAEAYPGNLTYTWYWQDENVYFQNDLKLRVRILIDGTLIIFRVKPEDSGKY 301

  Fly   243 KCIARNVVGKDTAD----TFVYP--VLN 264
            .|:..|.:|:..:.    |..||  |||
Human   302 TCVPSNSLGRSPSASAYLTVQYPARVLN 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 21/67 (31%)
IGSF9BNP_001264214.1 IG_like 30..115 CDD:214653
Ig 41..115 CDD:143165
I-set 139..225 CDD:254352 23/117 (20%)
IGc2 153..210 CDD:197706 12/70 (17%)
I-set 229..321 CDD:254352 23/91 (25%)
Ig 235..321 CDD:299845 22/85 (26%)
IG_like 331..414 CDD:214653
Ig <353..414 CDD:299845
IG_like 426..505 CDD:214653
Ig 442..505 CDD:299845
FN3 510..601 CDD:238020
FN3 617..699 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 758..817
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 911..1081
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.