Sequence 1: | NP_728961.2 | Gene: | ImpL2 / 38513 | FlyBaseID: | FBgn0001257 | Length: | 267 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_689957.3 | Gene: | SDK1 / 221935 | HGNCID: | 19307 | Length: | 2213 | Species: | Homo sapiens |
Alignment Length: | 202 | Identity: | 51/202 - (25%) |
---|---|---|---|
Similarity: | 79/202 - (39%) | Gaps: | 39/202 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 60 FTKTPPTKLQQADGATIEIVCEMMGSQVPSIQWVVGHLPRSELDDLDSNQVAEEAPSAIVRVR-- 122
Fly 123 SSHIIDHVLS----EARTYTCVGRTGSKTIYASTVVHPPRSSRLTPEKTYPGAQKPRIIYTEKTH 183
Fly 184 LDLMGSNIQLPCRVHARPRAEITWLNNENKEIVQGH----RHRVLANGDLLISEIKWEDMGNYKC 244
Fly 245 IARNVVG 251 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ImpL2 | NP_728961.2 | IGc2 | 187..251 | CDD:197706 | 23/67 (34%) |
SDK1 | NP_689957.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..73 | ||
I-set | 104..188 | CDD:254352 | |||
Ig | 122..176 | CDD:143165 | |||
Ig | 219..265 | CDD:299845 | |||
IGc2 | 312..364 | CDD:197706 | |||
I-set | 386..475 | CDD:254352 | 22/87 (25%) | ||
Ig | 404..472 | CDD:143165 | 17/68 (25%) | ||
I-set | 480..570 | CDD:254352 | 28/109 (26%) | ||
Ig | 494..570 | CDD:299845 | 24/68 (35%) | ||
I-set | 575..664 | CDD:254352 | |||
Ig | 580..664 | CDD:299845 | |||
FN3 | 668..759 | CDD:238020 | |||
fn3 | 771..857 | CDD:278470 | |||
FN3 | 872..967 | CDD:238020 | |||
FN3 | 972..1054 | CDD:238020 | |||
FN3 | 1070..1166 | CDD:238020 | |||
FN3 | 1176..1271 | CDD:238020 | |||
fn3 | 1279..1365 | CDD:278470 | |||
FN3 | 1378..1471 | CDD:238020 | |||
FN3 | 1477..1572 | CDD:238020 | |||
FN3 | 1580..1694 | CDD:238020 | |||
FN3 | 1704..1797 | CDD:238020 | |||
FN3 | 1802..1883 | CDD:238020 | |||
FN3 | 1903..1996 | CDD:238020 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 2075..2098 | ||||
PDZ-binding. /evidence=ECO:0000250|UniProtKB:Q6V4S5 | 2207..2213 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |