DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and zig-2

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_510069.1 Gene:zig-2 / 192087 WormBaseID:WBGene00006979 Length:238 Species:Caenorhabditis elegans


Alignment Length:268 Identity:75/268 - (27%)
Similarity:110/268 - (41%) Gaps:50/268 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLLFGSIATVRGRAVDLVDDSNDVDNSIEAEEEKPRNRAFEADWLKFTKTPPTKLQQADGATIEI 78
            :|.|.:|:.|...|.:.||            .:||.........||||:| |.......|....:
 Worm     1 MLKFTAISFVLLNAAESVD------------HQKPIRALDSQPLLKFTRT-PNDSNVTFGEKFVL 52

  Fly    79 VCEMMGSQVPSIQW------VVGHLPRSELDDL--DSNQVAEEA--------PSAIVRVRSSH-- 125
            .|...|:.:|||.|      :.|....:..:::  |..||:..|        |.|..|...::  
 Worm    53 SCGANGAPLPSIYWELNGMRIQGEETSNVYENILNDGKQVSNAAMVSSHYRIPCATARNSGAYKC 117

  Fly   126 IIDHVLSEARTYTCVGRTGSKTIYASTVVHPPRSSRLTPEKTYPGAQKPRIIYTEKTHLDLMGSN 190
            |||:.|::......|...|:||           :..|...    ||  |.|..|....|::..:.
 Worm   118 IIDNGLTKLEHVAKVFVGGNKT-----------NCALNDN----GA--PFISMTVDFRLEISNNA 165

  Fly   191 IQLPCRVHARPRAEITWLNNENKEIVQGHRHRVLANGDLLISEIKWEDMGNYKCIARNVVGKDTA 255
            :.|.||  :....|.:|...|......|.|:::..:|||:|..|.|.|||.|.|.|||..|:.||
 Worm   166 VALSCR--SETATEWSWHKGEQLLTNDGERYQMFPSGDLIIRNISWSDMGEYNCTARNHFGETTA 228

  Fly   256 DTFVYPVL 263
            .||:||.|
 Worm   229 ITFLYPTL 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 22/63 (35%)
zig-2NP_510069.1 I-set 34..134 CDD:254352 25/100 (25%)
Ig 34..121 CDD:299845 22/87 (25%)
Ig <179..232 CDD:299845 22/52 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I7501
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I3779
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482790at2759
OrthoFinder 1 1.000 - - FOG0008028
OrthoInspector 1 1.000 - - otm14515
orthoMCL 1 0.900 - - OOG6_111814
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X10535
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.730

Return to query results.
Submit another query.