DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and rig-3

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_509155.1 Gene:rig-3 / 180958 WormBaseID:WBGene00004370 Length:487 Species:Caenorhabditis elegans


Alignment Length:382 Identity:69/382 - (18%)
Similarity:101/382 - (26%) Gaps:184/382 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AKMNLHVCALALLLFGSIATV-------RGRAVDLVDDSNDVD-NSIEAEEEKPR--NRAFEAD- 56
            |||   :..||:.||.|..:.       ....:.:..::.|.| |:|...|.|..  :..||:| 
 Worm     6 AKM---LFPLAMCLFVSAVSASDSPSSNEANPIVISSEAMDYDTNTITVREGKKLMVSCVFESDE 67

  Fly    57 --------WLKFTKTPPTKLQQADGATIEIVCEMMGSQVPSIQWVVGHLPRSELDDLDSNQVAEE 113
                    |           :||:|..|:      |...||:..|:       |::..|..    
 Worm    68 QIHKSDLLW-----------KQANGNNID------GESNPSLFSVI-------LNEKGSKH---- 104

  Fly   114 APSAIVRVRSSHIIDHVLSEARTYTCVGRTGSKTIYASTVVHPPRSSRLTPEKTYPGAQKPRIIY 178
                  |..|.|.......:...|||.|||.....:               |||......|.|.:
 Worm   105 ------RKTSLHFSSVHTRDTGLYTCTGRTAGGENF---------------EKTIKLVVLPAIEW 148

  Fly   179 TEKTHLD--LMGSNIQLPCRV---------------HARPRAEITW-----------LNNENKE- 214
            .:|..:.  |:|..|.:.|.|               :..|..|..|           |..|:.| 
 Worm   149 NDKDTVKGALLGEPITIDCGVKGPSGKEPMIQMTNGNGEPLDEEIWTIAGNEATIDSLKKEHAEL 213

  Fly   215 ---------------------------------------------IVQGH--------------- 219
                                                         ::..|               
 Worm   214 TVSCITIEMHQETSKEEFPVVDRKDVNIEVYTLPEFETEESVQYTVIDNHVRDAIIYCNVTHSFP 278

  Fly   220 --RHRVLANGD----------------------LLISEIKWEDMGNYKCIARNVVGK 252
              ||....:||                      |.|..:...|:|.|||.|.|:..|
 Worm   279 PVRHYTFYHGDEEIKMSDKFNIFVNVGVSQGAHLKIHNVNENDLGTYKCEANNIKAK 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 24/174 (14%)
rig-3NP_509155.1 IG_like 48..142 CDD:214653 29/142 (20%)
Ig 267..341 CDD:319273 14/69 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.