Sequence 1: | NP_728961.2 | Gene: | ImpL2 / 38513 | FlyBaseID: | FBgn0001257 | Length: | 267 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_509155.1 | Gene: | rig-3 / 180958 | WormBaseID: | WBGene00004370 | Length: | 487 | Species: | Caenorhabditis elegans |
Alignment Length: | 382 | Identity: | 69/382 - (18%) |
---|---|---|---|
Similarity: | 101/382 - (26%) | Gaps: | 184/382 - (48%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 AKMNLHVCALALLLFGSIATV-------RGRAVDLVDDSNDVD-NSIEAEEEKPR--NRAFEAD- 56
Fly 57 --------WLKFTKTPPTKLQQADGATIEIVCEMMGSQVPSIQWVVGHLPRSELDDLDSNQVAEE 113
Fly 114 APSAIVRVRSSHIIDHVLSEARTYTCVGRTGSKTIYASTVVHPPRSSRLTPEKTYPGAQKPRIIY 178
Fly 179 TEKTHLD--LMGSNIQLPCRV---------------HARPRAEITW-----------LNNENKE- 214
Fly 215 ---------------------------------------------IVQGH--------------- 219
Fly 220 --RHRVLANGD----------------------LLISEIKWEDMGNYKCIARNVVGK 252 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ImpL2 | NP_728961.2 | IGc2 | 187..251 | CDD:197706 | 24/174 (14%) |
rig-3 | NP_509155.1 | IG_like | 48..142 | CDD:214653 | 29/142 (20%) |
Ig | 267..341 | CDD:319273 | 14/69 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |