DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and Ncam1

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_006510118.1 Gene:Ncam1 / 17967 MGIID:97281 Length:1162 Species:Mus musculus


Alignment Length:267 Identity:70/267 - (26%)
Similarity:105/267 - (39%) Gaps:65/267 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DDSND-----VDNSIEAEEE-KPRNRAFEAD---WLK-FTKTPPTKLQQADGATIE----IVCEM 82
            |||::     ||.:.|||.. ...|:|.|.|   .|| |.|...|.::......:|    :.||.
Mouse   268 DDSSELTIRNVDKNDEAEYVCIAENKAGEQDASIHLKVFAKPKITYVENQTAMELEEQVTLTCEA 332

  Fly    83 MGSQVPSIQWVVGHLPRSELDDLDSNQVA-------EEAPSAIVRVRSSHIIDHVLSEARTYTCV 140
            .|..:|||.|      |:...::.|.:.|       :|.....:.|||...:..:..::..||..
Mouse   333 SGDPIPSITW------RTSTRNISSEEKASWTRPEKQETLDGHMVVRSHARVSSLTLKSIQYTDA 391

  Fly   141 GR---TGSKTIYASTVVHPPRSSRLTPEKTY-PGAQKPRIIYTEKTHLDLMGSNIQLPCRVHARP 201
            |.   |.|.||...       |..:..|..| |..|.|..:||.:      |:.:.:.|.|.|.|
Mouse   392 GEYICTASNTIGQD-------SQSMYLEVQYAPKLQGPVAVYTWE------GNQVNITCEVFAYP 443

  Fly   202 RAEITWL---------NNENKEIVQGHRHRVLANGDLLISEIKWEDMGNYKCIARNVVGKDT--- 254
            .|.|:|.         |..|.:|     :...:...|.::.....|.|||.|.|.|.:|:::   
Mouse   444 SATISWFRDGQLLPSSNYSNIKI-----YNTPSASYLEVTPDSENDFGNYNCTAVNRIGQESLEF 503

  Fly   255 ----ADT 257
                |||
Mouse   504 ILVQADT 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 19/72 (26%)
Ncam1XP_006510118.1 Ig1_NCAM-1 20..115 CDD:143273
IG 124..190 CDD:214652
Ig3_NCAM-1_like 211..308 CDD:143207 15/39 (38%)
Ig_NCAM-1 307..413 CDD:143277 25/118 (21%)
Ig_3 417..494 CDD:372822 23/87 (26%)
FN3 509..606 CDD:238020 2/2 (100%)
fn3 649..731 CDD:365830
PHA03247 <905..1140 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.