DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ImpL2 and Dscam

DIOPT Version :9

Sequence 1:	NP_728961.2	Gene:	ImpL2 / 38513	FlyBaseID:	FBgn0001257	Length:	267	Species:	Drosophila melanogaster
Sequence 2:	XP_038943864.1	Gene:	Dscam / 171119	RGDID:	619992	Length:	2034	Species:	Rattus norvegicus

Alignment Length:	198	Identity:	42/198 - (21%)
Similarity:	80/198 - (40%)	Gaps:	37/198 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly    73 GATIEIVCEMMGSQVPSIQWVVGHLPRSELDDLDSNQVAEEAPSAIVRVRSSHIIDHVLSEARTY 137
            |..:|:.|:.:|...|..:|:..::|      |:.:...::..:.::...|..      |::.:|
  Rat   239 GQRVELPCKALGHPEPDYRWLKDNMP------LELSGRFQKTVTGLLIENSRP------SDSGSY 291

  Fly   138 TC--VGRTGSKTIYASTVVHPPRSSRLTPEKTYPGAQKPRIIYTEKTHLDLMGSNIQLPCRVHAR 200
            .|  ..|.|:..:.....|..|..:.::|.|....                :||.:.|.|.|...
  Rat   292 VCEVSNRYGTAKVIGRLYVKQPLKATISPRKVKSS----------------VGSQVSLSCSVTGN 340

  Fly   201 PRAEITWLNNENKEIVQ-GHRHRV--LANGDLLISEIKWEDMGNYKCIARNVVGKDTADTFVYPV 262
            ...|::|.  .|.||:. |...|:  |.:.:|::..:...|.|.|:|..|.  .|.:|..:|..|
  Rat   341 EDQELSWY--RNGEILNPGKNVRITGLNHANLIMDHMVKSDGGAYQCFVRK--DKLSAQDYVQVV 401

  Fly   263 LNE 265
            |.:
  Rat   402 LED 404

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ImpL2	NP_728961.2	IGc2	187..251	CDD:197706	19/66 (29%)
Dscam	XP_038943864.1	Ig	26..121	CDD:416386
		Ig strand A'	33..37	CDD:409353
		Ig strand B	40..49	CDD:409353
		Ig strand C	55..61	CDD:409353
		Ig strand C'	63..66	CDD:409353
		Ig strand D	72..75	CDD:409353
		Ig strand E	80..85	CDD:409353
		Ig strand F	98..106	CDD:409353
		Ig strand G	109..121	CDD:409353
		Ig	125..210	CDD:416386
		Ig strand A	126..130	CDD:409353
		Ig strand A'	132..136	CDD:409353
		Ig strand B	139..149	CDD:409353
		Ig strand C	157..163	CDD:409353
		Ig strand C'	164..167	CDD:409353
		Ig strand E	179..185	CDD:409353
		Ig strand F	191..201	CDD:409353
		IGc2	239..300	CDD:197706	13/72 (18%)
		Ig strand B	242..246	CDD:409353	1/3 (33%)
		Ig strand C	255..259	CDD:409353	0/3 (0%)
		Ig strand F	290..295	CDD:409353	2/4 (50%)
		Ig	313..395	CDD:416386	23/101 (23%)
		Ig strand A	314..319	CDD:409353	0/4 (0%)
		Ig strand A'	322..326	CDD:409353	1/3 (33%)
		Ig strand B	329..339	CDD:409353	4/9 (44%)
		Ig strand C	344..350	CDD:409353	2/7 (29%)
		Ig strand C'	351..354	CDD:409353	1/2 (50%)
		Ig strand E	368..374	CDD:409353	1/5 (20%)
		Ig strand F	381..389	CDD:409353	3/7 (43%)
		Ig	406..501	CDD:416386
		Ig strand A	406..409	CDD:409353
		Ig strand A'	415..419	CDD:409353
		Ig strand B	422..431	CDD:409353
		Ig strand C	436..442	CDD:409353
		Ig strand C'	444..447	CDD:409353
		Ig strand D	452..460	CDD:409353
		Ig strand E	464..473	CDD:409353
		Ig strand F	480..488	CDD:409353
		Ig strand G	491..501	CDD:409353
		Ig	504..593	CDD:416386
		Ig strand A	505..507	CDD:409353
		Ig strand A'	512..516	CDD:409353
		Ig strand B	519..526	CDD:409353
		Ig strand C	533..539	CDD:409353
		Ig strand C'	540..542	CDD:409353
		Ig strand D	549..553	CDD:409353
		Ig strand E	557..563	CDD:409353
		Ig strand F	571..579	CDD:409353
		Ig strand G	583..593	CDD:409353
		Ig	596..686	CDD:416386
		Ig strand A	597..599	CDD:409353
		Ig strand B	611..620	CDD:409353
		Ig strand C	625..632	CDD:409353
		Ig strand C'	634..636	CDD:409353
		Ig strand D	643..648	CDD:409353
		Ig strand E	651..658	CDD:409353
		Ig strand F	665..673	CDD:409353
		Ig strand G	676..685	CDD:409353
		Ig_DSCAM	689..784	CDD:409397
		Ig strand B	707..711	CDD:409397
		Ig strand C	720..724	CDD:409397
		Ig strand E	749..753	CDD:409397
		Ig strand F	763..768	CDD:409397
		Ig strand G	777..780	CDD:409397
Ig_DSCAM	785..884	CDD:409398
Ig strand B	805..809	CDD:409398
Ig strand C	818..822	CDD:409398
Ig strand E	848..852	CDD:409398
Ig strand F	862..867	CDD:409398
Ig strand G	875..878	CDD:409398
FN3	885..978	CDD:238020
FN3	986..1083	CDD:238020
FN3	1091..1184	CDD:238020
FN3	1189..1278	CDD:238020
Ig_3	1287..1363	CDD:404760
Ig strand B	1303..1307	CDD:409353
Ig strand C	1316..1320	CDD:409353
Ig strand E	1342..1346	CDD:409353
Ig strand F	1356..1361	CDD:409353
FN3	1380..1470	CDD:238020
FN3	1486..1555	CDD:238020
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3510
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900