DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and Emb

DIOPT Version :10

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_034460.3 Gene:Emb / 13723 MGIID:95321 Length:330 Species:Mus musculus


Alignment Length:274 Identity:51/274 - (18%)
Similarity:99/274 - (36%) Gaps:51/274 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLLFGSIATVRGRAVDLVDDSNDVDNSIEAEEE---KPRNRAFEADWLKFTKTPPTKLQQ----A 71
            |||...:|..|....: .|.::....|:...||   |..|.:.::..:..|:.....:::    .
Mouse    17 LLLLCLLAATRPDPAE-GDPTDPTFTSLPVREEMMAKYSNLSLKSCNISVTEKSNVSVEENVILE 80

  Fly    72 DGATIEIVCEMMGSQ---VPSIQWVVGHLPRSELDDLDSNQVAEEAPSAIVRVRSSHIIDHVLSE 133
            ..:.:|:.|....::   :.::.|.....|.....|.::.::.....|      ....|.....:
Mouse    81 KPSHVELKCVYTATKDLNLMNVTWKKDDEPLETTGDFNTTKMGNTLTS------QYRFIVFNSKQ 139

  Fly   134 ARTYTCVGRTGSKTIYASTVVHPPRSSRLTPEKTYPGAQKPRIIYTEKTHLDLMGSNIQLPCRVH 198
            ...|:||  .|.|.:..:..:|.|::.         |.:|..|.|        :|.:..|.|...
Mouse   140 LGKYSCV--FGEKELRGTFNIHVPKAH---------GKKKSLIAY--------VGDSTVLKCVCQ 185

  Fly   199 ARPRAEITW-LNNENKEI-VQGH-RHRVLANGD------LLISEIKWEDMGNYKCIARNVVGKDT 254
            .......|| :.||..:: :..| ..:.:.||.      |.|..:..||.|:|.|.|...:|:..
Mouse   186 DCLPLNWTWYMGNETAQVPIDAHSNEKYIINGSHANETRLKIKHLLEEDGGSYWCRATFQLGESE 250

  Fly   255 AD------TFVYPV 262
            ..      :|:.|:
Mouse   251 EQNELVVLSFLVPL 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 PHA02785 <74..246 CDD:165149 35/183 (19%)
Ig_3 173..248 CDD:464046 21/83 (25%)
EmbNP_034460.3 Ig 85..151 CDD:472250 11/73 (15%)
IG_like 168..257 CDD:214653 22/96 (23%)
Ig strand B 179..182 CDD:409353 1/2 (50%)
Ig strand C 191..195 CDD:409353 1/3 (33%)
Ig strand E 218..227 CDD:409353 1/8 (13%)
Ig strand F 237..242 CDD:409353 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..330
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.