Sequence 1: | NP_728961.2 | Gene: | ImpL2 / 38513 | FlyBaseID: | FBgn0001257 | Length: | 267 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006522949.1 | Gene: | Dscam / 13508 | MGIID: | 1196281 | Length: | 2034 | Species: | Mus musculus |
Alignment Length: | 198 | Identity: | 42/198 - (21%) |
---|---|---|---|
Similarity: | 80/198 - (40%) | Gaps: | 37/198 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 73 GATIEIVCEMMGSQVPSIQWVVGHLPRSELDDLDSNQVAEEAPSAIVRVRSSHIIDHVLSEARTY 137
Fly 138 TC--VGRTGSKTIYASTVVHPPRSSRLTPEKTYPGAQKPRIIYTEKTHLDLMGSNIQLPCRVHAR 200
Fly 201 PRAEITWLNNENKEIVQ-GHRHRV--LANGDLLISEIKWEDMGNYKCIARNVVGKDTADTFVYPV 262
Fly 263 LNE 265 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ImpL2 | NP_728961.2 | IGc2 | 187..251 | CDD:197706 | 19/66 (29%) |
Dscam | XP_006522949.1 | Ig | 15..115 | CDD:386229 | |
IGc2 | 239..300 | CDD:197706 | 13/72 (18%) | ||
IG | 320..400 | CDD:214652 | 24/99 (24%) | ||
Ig_3 | 410..488 | CDD:372822 | |||
IGc2 | 518..575 | CDD:197706 | |||
Ig | 596..686 | CDD:386229 | |||
Ig_DSCAM | 707..784 | CDD:143211 | |||
Ig | 802..889 | CDD:386229 | |||
FN3 | 885..978 | CDD:238020 | |||
FN3 | 986..1083 | CDD:238020 | |||
FN3 | 1091..1184 | CDD:238020 | |||
FN3 | 1189..1278 | CDD:238020 | |||
Ig_3 | 1301..1363 | CDD:372822 | |||
FN3 | 1380..1470 | CDD:238020 | |||
FN3 | 1486..1555 | CDD:238020 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |