DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and Kirrel2

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_038957463.1 Gene:Kirrel2 / 100359836 RGDID:1308456 Length:711 Species:Rattus norvegicus


Alignment Length:260 Identity:55/260 - (21%)
Similarity:87/260 - (33%) Gaps:69/260 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RGRAVDLVDD--------SNDVDNSIEAEEEKPRNRAFEADWLKFTKTPPTKLQQADGATIEIVC 80
            ||..:::|.|        |.:|.|::.:..   |:.|.|..:....:..|..:....|......|
  Rat   280 RGPRLEVVADATFLTEPVSCEVSNAVGSAN---RSTALEVLYGPILQAKPKPVSVDVGKDASFSC 341

  Fly    81 EMMGSQVPSIQWVVGHLPRSELDDLDSNQVAEEAPSAIVRVRSSHIIDHVLSEARTYTC------ 139
            ...|:.:|.|.|.          .|..:||....|:  :|:.|.     .|.:|..|.|      
  Rat   342 VWRGNPLPRISWT----------RLGGSQVLSSGPT--LRLPSV-----ALEDAGDYVCRAEPRR 389

  Fly   140 VGRTGSKTIYASTVVHPPRSSRLTPEKTYPGAQKPRIIYTEKTHLDLMGSNIQLPCRVHARPRAE 204
            .|..|.......||..||..:.|.|...:                 |.|. .:|.|.|.|.|..:
  Rat   390 TGVGGGTAQARLTVNAPPVVTALHPAPAF-----------------LRGP-ARLQCVVFASPAPD 436

  Fly   205 -ITWLNNE--------NKEIVQGHRHRVLANGD-------LLISEIKWEDM-GNYKCIARNVVGK 252
             :.|..:|        .:.:|:......:..|.       |.||..:..|. ..:.|.|||.:|:
  Rat   437 SVVWSWDEGFLEAGSLGRFLVEAFPAPEVEGGQGPGLISVLHISGTQESDFTTGFNCSARNRLGE 501

  Fly   253  252
              Rat   502  501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 18/80 (23%)
Kirrel2XP_038957463.1 IG_like 38..127 CDD:214653
Ig strand A' 40..44 CDD:409353
Ig strand B 48..57 CDD:409353
Ig strand C 62..66 CDD:409353
Ig strand D 75..85 CDD:409353
Ig strand E 88..100 CDD:409353
Ig strand F 107..115 CDD:409353
Ig strand G 117..127 CDD:409353
Ig 133..231 CDD:416386
Ig strand A 134..137 CDD:409353
Ig strand A' 140..144 CDD:409353
Ig strand B 151..158 CDD:409353
Ig strand C 164..169 CDD:409353
Ig strand C' 172..174 CDD:409353
Ig strand D 177..184 CDD:409353
Ig strand E 191..199 CDD:409353
Ig strand F 208..216 CDD:409353
Ig strand G 222..228 CDD:409353
Ig_3 234..303 CDD:404760 6/22 (27%)
Ig strand B 252..256 CDD:409353
Ig strand C 266..270 CDD:409353
Ig strand E 283..286 CDD:409353 0/2 (0%)
Ig strand F 292..301 CDD:409353 1/8 (13%)
Ig strand G 309..312 CDD:409353 1/5 (20%)
Ig 326..403 CDD:416386 19/93 (20%)
Ig strand A' 327..332 CDD:409353 0/4 (0%)
Ig strand B 335..344 CDD:409353 1/8 (13%)
Ig strand C 350..354 CDD:409353 1/3 (33%)
Ig strand C' 357..359 CDD:409353 0/1 (0%)
Ig strand D 362..365 CDD:409353 0/2 (0%)
Ig strand E 366..371 CDD:409353 2/6 (33%)
Ig strand F 379..387 CDD:409353 2/7 (29%)
Ig strand G 393..403 CDD:409353 1/9 (11%)
Ig 405..509 CDD:416386 24/115 (21%)
Ig strand A 406..410 CDD:409353 2/3 (67%)
Ig strand A' 412..415 CDD:409353 1/2 (50%)
Ig strand B 423..430 CDD:409353 2/6 (33%)
Ig strand C 437..442 CDD:409353 1/4 (25%)
Ig strand C' 444..447 CDD:409353 1/2 (50%)
Ig strand D 455..462 CDD:409353 1/6 (17%)
Ig strand E 472..479 CDD:409353 1/6 (17%)
Ig strand F 490..497 CDD:409353 2/6 (33%)
Ig strand G 500..507 CDD:409353 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.