DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and kirrel1b

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_017212964.1 Gene:kirrel1b / 100170816 ZFINID:ZDB-GENE-070912-173 Length:801 Species:Danio rerio


Alignment Length:353 Identity:63/353 - (17%)
Similarity:101/353 - (28%) Gaps:156/353 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 AVDLVDDSNDVDNSIEAEEEKPRNRAFEADWLKFTKTPPTKLQQADGATIE-------------- 77
            :.||.|||.   ...:|.|...|:|..:...|    .||      ||..||              
Zfish    93 SADLTDDSL---YECQATEAALRSRRAKLTVL----IPP------DGPVIEGSPEILLTAGTSFN 144

  Fly    78 IVCEMMGSQ-VPSIQWVVGHLPRSELDDLDSNQVAEEAPSAIVRVRSSHIIDHVLSE-------- 133
            :.|...|:: :.:|:|.                     ...|: |..:|....|||:        
Zfish   145 LTCVSRGAKPMSTIEWY---------------------KDGII-VEGAHTSTEVLSDRKRVTTKS 187

  Fly   134 -----------ARTYTCVGRT-----GSKTIYASTVVHPPR-------SSRLTPEK---TYPGAQ 172
                       .|.:|||...     |.::.....:.|||.       .|.|..|:   |.....
Zfish   188 FLEIQPMDTDTGRNFTCVASNLAAPLGKRSTVTLNIHHPPTVILSIEPRSVLEGERVKFTCQATA 252

  Fly   173 KPRII---------------------------YTE-----------KTHLDLM------------ 187
            .|.|:                           :||           .|::.::            
Zfish   253 NPPIMGYRWAKGGVILDGARESVFETTADHSFFTEPVSCLVFNAVGSTNVSILVDVHFGPILVVE 317

  Fly   188 --------GSNIQLPCRVHARPRAEITWLNNENKEIVQGHRHRVLANGD-LLISEIKWEDMGNYK 243
                    .|::.|.|:....|...:||....:.        .||:|.: |.:..:...|.|.|.
Zfish   318 PRPVTVDVDSDVTLNCKWSGNPPLTLTWTKKGSS--------MVLSNSNQLFLKSVSQADAGQYV 374

  Fly   244 C---IARNVVGKDTADTFVY--PVLNEE 266
            |   :.|..||:......|.  |:::.|
Zfish   375 CKAIVPRIGVGETEVTLTVNGPPIISSE 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 15/87 (17%)
kirrel1bXP_017212964.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.