DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and lrit3b

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_009305418.1 Gene:lrit3b / 100144406 ZFINID:ZDB-GENE-070424-130 Length:487 Species:Danio rerio


Alignment Length:221 Identity:45/221 - (20%)
Similarity:78/221 - (35%) Gaps:72/221 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 FTKTPPTKLQQADGATIEIVCEMMGSQVPSIQWV---------VGHLPRSELDDLDSNQ------ 109
            :..|..||:....|:|:.:.||..|...|::.|:         .|...::: ..||:.:      
Zfish   280 YVVTSATKITALLGSTVLLRCEATGHPTPALMWIKSAKRNLYNQGCCKQTQ-SSLDTERFPKKLF 343

  Fly   110 -VAEEAPSAIVR--VRSSHIIDHVLSEARTYTCVGRTG---SKTIYASTVV-------------- 154
             ..:|:|...||  |.|.:.|.:  |:|..|.|..:..   |:.:.:..||              
Zfish   344 GYVQESPRVGVRWSVVSLNGISY--SDAGEYRCRAQNMAGISEAVVSLNVVGVMAEYTDFKNSDQ 406

  Fly   155 ------------HPPRSSRLTPEKTYPGAQKP--RIIYTEKTHLDLMGSNIQLPCRVHARPRAEI 205
                        .|.:.|:....:...|:..|  |::.|.|...|.|           .|.|..:
Zfish   407 QQTTTKSDSKRTKPKQKSKAMMPRNMTGSLSPLKRVLKTPKAGRDKM-----------KRDRTAV 460

  Fly   206 TWLNNENKEIVQGHRHRVLANGDLLI 231
            ..|:         |||.:.|:.|.|:
Zfish   461 QKLS---------HRHFLTASDDSLL 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 10/45 (22%)
lrit3bXP_009305418.1 LRRNT 51..92 CDD:214470
leucine-rich repeat 69..89 CDD:275380
LRR_8 112..172 CDD:290566
leucine-rich repeat 114..137 CDD:275378
leucine-rich repeat 138..161 CDD:275378
LRR_8 160..214 CDD:290566
LRR_4 160..201 CDD:289563
leucine-rich repeat 162..185 CDD:275378
leucine-rich repeat 186..199 CDD:275378
leucine-rich repeat 215..230 CDD:275378
Ig 278..391 CDD:299845 25/113 (22%)
I-set 279..391 CDD:254352 25/113 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.