DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Ad and LOC5667274

DIOPT Version :10

Sequence 1:NP_647875.1 Gene:Cpr64Ad / 38511 FlyBaseID:FBgn0035513 Length:247 Species:Drosophila melanogaster
Sequence 2:XP_061496521.1 Gene:LOC5667274 / 5667274 VectorBaseID:AGAMI1_012041 Length:287 Species:Anopheles gambiae


Alignment Length:91 Identity:43/91 - (47%)
Similarity:56/91 - (61%) Gaps:1/91 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 PVAAPLAAPVAAPLAAPVAAPIATEIVDAHPQYKFAYDVQDTLTGDSKTQEETRDGDVVRGSYSL 178
            |....:.....|.||..||| ...|...:||.|||.|.|:|..|||.|:|.|.||||||:|:|:|
Mosquito   157 PKMMKITIAALALLAVAVAA-YEHEDYHSHPSYKFKYGVKDPHTGDHKSQWEHRDGDVVKGAYTL 220

  Fly   179 IEPDGSRRIVSYYADSINGFNAVVQK 204
            .|.||::|:|.|.:|..|||.|.|::
Mosquito   221 DEADGTKRVVEYSSDKHNGFQAHVKR 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AdNP_647875.1 Chitin_bind_4 146..198 CDD:459790 29/51 (57%)
LOC5667274XP_061496521.1 None

Return to query results.
Submit another query.