DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Ad and LOC4578374

DIOPT Version :10

Sequence 1:NP_647875.1 Gene:Cpr64Ad / 38511 FlyBaseID:FBgn0035513 Length:247 Species:Drosophila melanogaster
Sequence 2:XP_001238119.1 Gene:LOC4578374 / 4578374 VectorBaseID:AGAMI1_013081 Length:132 Species:Anopheles gambiae


Alignment Length:60 Identity:25/60 - (41%)
Similarity:37/60 - (61%) Gaps:0/60 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 YKFAYDVQDTLTGDSKTQEETRDGDVVRGSYSLIEPDGSRRIVSYYADSINGFNAVVQKD 205
            |::.|||.|..|||...|:|.|..|..:|.|.||:.||.:|.|:|:.:..:||.|.|.::
Mosquito    44 YEYHYDVHDDHTGDVHGQKEARKDDSTQGEYYLIDADGHKRTVTYHVEGKSGFIAEVHRE 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AdNP_647875.1 Chitin_bind_4 146..198 CDD:459790 21/51 (41%)
LOC4578374XP_001238119.1 Chitin_bind_4 44..96 CDD:459790 21/51 (41%)

Return to query results.
Submit another query.