DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Ad and Cpr92F

DIOPT Version :9

Sequence 1:NP_647875.1 Gene:Cpr64Ad / 38511 FlyBaseID:FBgn0035513 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_650905.2 Gene:Cpr92F / 42450 FlyBaseID:FBgn0038819 Length:381 Species:Drosophila melanogaster


Alignment Length:132 Identity:44/132 - (33%)
Similarity:60/132 - (45%) Gaps:26/132 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 AAPLAAPVAA----PIATEI--VDAHPQ-YKFAYDVQDTLTGDSKTQE-ETRDGD-VVRGSYSLI 179
            ||.|.:.|:|    .::|:.  :|.|.. |.:.|       .|..:|: |||..| ...||||.:
  Fly     8 AALLISTVSASWHGAVSTQYQHLDPHSHTYSYGY-------ADPNSQKHETRSHDGTTHGSYSYV 65

  Fly   180 EPDGSRRIVSYYADSINGFNAV---VQKDVPVAVAPV-APVLAKTVAAPVA------PVVAAAPA 234
            :..|..:.|||.||..:|||||   :.:...|..||| |...|....||.|      ||:.....
  Fly    66 DGHGHVQSVSYTADPHHGFNAVGTNLPQAPQVHAAPVYAAAHAHGAYAPYAHGPIHIPVLTHGGV 130

  Fly   235 PV 236
            ||
  Fly   131 PV 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AdNP_647875.1 Chitin_bind_4 146..198 CDD:306811 18/53 (34%)
Cpr92FNP_650905.2 Chitin_bind_4 37..84 CDD:278791 18/53 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.