DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Ad and Ccp84Ab

DIOPT Version :9

Sequence 1:NP_647875.1 Gene:Cpr64Ad / 38511 FlyBaseID:FBgn0035513 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_649682.1 Gene:Ccp84Ab / 40824 FlyBaseID:FBgn0004782 Length:221 Species:Drosophila melanogaster


Alignment Length:173 Identity:89/173 - (51%)
Similarity:101/173 - (58%) Gaps:15/173 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 FAAPFAAPVAPVAARLAAPVAAPLAAPVAPVAAPLA-APVAAPLAAPVAAPIATEIVDAHPQYKF 148
            |...||.....||:...||:|||.....||..|..| ||||  :|..|....|.| .|.||||:|
  Fly     3 FKFVFALAFVAVASAGYAPIAAPQVYHAAPAVATYAHAPVA--VAQKVVVKAAEE-YDPHPQYRF 64

  Fly   149 AYDVQDTLTGDSKTQEETRDGDVVRGSYSLIEPDGSRRIVSYYADSINGFNAVVQKDVPVAVAPV 213
            :|.|.|.||||:|.|.|.||||||||.||||:.||.:|.|.|.||.||||||||.::..|....|
  Fly    65 SYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVVNREPLVKAVAV 129

  Fly   214 APVLAKTVAAPV----APVVAAAPAPVFAKTL------AAPIV 246
            |||: |||||||    ||.||...||...||:      |||.|
  Fly   130 APVV-KTVAAPVAQYAAPAVAHYAAPAVVKTVAPVAHYAAPAV 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AdNP_647875.1 Chitin_bind_4 146..198 CDD:306811 33/51 (65%)
Ccp84AbNP_649682.1 Chitin_bind_4 62..114 CDD:278791 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.