DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Ad and Ccp84Ae

DIOPT Version :9

Sequence 1:NP_647875.1 Gene:Cpr64Ad / 38511 FlyBaseID:FBgn0035513 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_649679.1 Gene:Ccp84Ae / 40821 FlyBaseID:FBgn0004779 Length:208 Species:Drosophila melanogaster


Alignment Length:169 Identity:80/169 - (47%)
Similarity:103/169 - (60%) Gaps:21/169 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 AAPVAPVAARLAAPVAAPL--AAPVAPVAAPLAAPVAAPLAAPVAAPIATEIVDAHPQYKFAYDV 152
            ||.:....|..|....|.|  |||||..:||:  ||       :|..:..|.||.||||.::|||
  Fly     2 AAKIVIALALFAVAHGAVLRTAAPVAVASAPV--PV-------LAKTVELEEVDPHPQYTYSYDV 57

  Fly   153 QDTLTGDSKTQEETRDGDVVRGSYSLIEPDGSRRIVSYYADSINGFNAVVQKD---VPVAVAPV- 213
            ||||:||:|...|.||||||||.||||:.||.:|.|:|.|||||||||||:::   ..||..|: 
  Fly    58 QDTLSGDNKGHVEERDGDVVRGEYSLIDADGFKRTVTYTADSINGFNAVVRREPLAAVVAAEPLL 122

  Fly   214 ---APVLAKTVAAPVAPVVAAAPAPVFAK---TLAAPIV 246
               ||::.....||:|||..|||||:...   .:|||::
  Fly   123 KVAAPLVKAAPVAPIAPVALAAPAPIVRSAPVAVAAPLI 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AdNP_647875.1 Chitin_bind_4 146..198 CDD:306811 34/51 (67%)
Ccp84AeNP_649679.1 Chitin_bind_4 51..103 CDD:278791 34/51 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.