DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Ad and Edg84A

DIOPT Version :9

Sequence 1:NP_647875.1 Gene:Cpr64Ad / 38511 FlyBaseID:FBgn0035513 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster


Alignment Length:110 Identity:53/110 - (48%)
Similarity:68/110 - (61%) Gaps:6/110 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 AAPLAAPVAAPIATEIVDAHPQYKFAYDVQDTLTGDSKTQEETRDGDVVRGSYSLIEPDGSRRIV 188
            |.||  |..:..:.:..|:||||.|.|||||..|||.|:|.|:||||||.|.||:.:.||.||.|
  Fly    17 AGPL--PAKSSGSEDTYDSHPQYSFNYDVQDPETGDVKSQSESRDGDVVHGQYSVNDADGYRRTV 79

  Fly   189 SYYADSINGFNAVVQKDVPVAVAPVAPVLAKTVAAPVAPVVAAAP 233
            .|.||.:.||||||::: |::   .|.|:.|..|..|.|.|...|
  Fly    80 DYTADDVRGFNAVVRRE-PLS---SAAVVVKPQATAVVPKVQLKP 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AdNP_647875.1 Chitin_bind_4 146..198 CDD:306811 30/51 (59%)
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:278791 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.