DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Ad and Cpr64Aa

DIOPT Version :9

Sequence 1:NP_647875.1 Gene:Cpr64Ad / 38511 FlyBaseID:FBgn0035513 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_647872.1 Gene:Cpr64Aa / 38508 FlyBaseID:FBgn0035510 Length:192 Species:Drosophila melanogaster


Alignment Length:157 Identity:83/157 - (52%)
Similarity:99/157 - (63%) Gaps:7/157 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 APVAARLAAPVAAP-LAAPVAPVAAPLAAPVAAPLAAPVAAPIATEIVDAHPQYKFAYDVQDTLT 157
            |.||...|..|..| ||.|..| :.|..|.|||||.|.||.|   |..|.:|||.|:|||.|..|
  Fly    11 ALVAVSSAVVVPGPGLALPAYP-SYPALAKVAAPLVAKVAGP---EPYDPNPQYTFSYDVHDGST 71

  Fly   158 GDSKTQEETRDGDVVRGSYSLIEPDGSRRIVSYYADSINGFNAVVQKD--VPVAVAPVAPVLAKT 220
            ||.|:|:|||.||||:|:|||||.||:||||.|.||.::||||||:::  |..||||||.|||..
  Fly    72 GDVKSQQETRSGDVVQGAYSLIEADGTRRIVEYTADPVHGFNAVVRREGAVVKAVAPVAKVLAPA 136

  Fly   221 VAAPVAPVVAAAPAPVFAKTLAAPIVA 247
            .....:|:||..||...|...|.|.:|
  Fly   137 PLLHASPLVAKVPAYGPALAPAYPALA 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AdNP_647875.1 Chitin_bind_4 146..198 CDD:306811 33/51 (65%)
Cpr64AaNP_647872.1 Chitin_bind_4 60..112 CDD:278791 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.