DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Ad and resilin

DIOPT Version :9

Sequence 1:NP_647875.1 Gene:Cpr64Ad / 38511 FlyBaseID:FBgn0035513 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_611157.1 Gene:resilin / 36880 FlyBaseID:FBgn0034157 Length:620 Species:Drosophila melanogaster


Alignment Length:239 Identity:64/239 - (26%)
Similarity:88/239 - (36%) Gaps:70/239 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SSMALSAQAGLVGAPLAAAPLGAPL-AYSAPLG-----PA-PYFAP----------AAYSAPLG- 57
            ||.:..|..|..|        |.|. .|.||.|     |: .|.||          ::|.||.| 
  Fly   168 SSSSYGAPGGGNG--------GRPSDTYGAPGGGNGGRPSDTYGAPGGGNNGGRPSSSYGAPGGG 224

  Fly    58 --------YAAPLGYNAPLVAGPAPLVSKTYAAA-------------PFAAP---------FAAP 92
                    |.||.|.|.   .|.....|.:|.|.             .:.||         :.||
  Fly   225 NGGRPSDTYGAPGGGNG---NGSGGRPSSSYGAPGQGQGGFGGRPSDSYGAPGQNQKPSDSYGAP 286

  Fly    93 VA-------PVAARLAAPVAAPLAAPVAPVAAPLAAPVAAPLAAPVAAPIATEIVDAHP-QYKFA 149
            .:       | ::...||.:.|...|......|.:...|.  .|..:.|...:..:..| :|:|.
  Fly   287 GSGNGNGGRP-SSSYGAPGSGPGGRPSDSYGPPASGSGAG--GAGGSGPGGADYDNDEPAKYEFN 348

  Fly   150 YDVQDTLTGDSKTQEETRDGDVVRGSYSLIEPDGSRRIVSYYAD 193
            |.|:|..:|.|....|.||||...|.|:::.|||.::||.|.||
  Fly   349 YQVEDAPSGLSFGHSEMRDGDFTTGQYNVLLPDGRKQIVEYEAD 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AdNP_647875.1 Chitin_bind_4 146..198 CDD:306811 22/48 (46%)
resilinNP_611157.1 Chitin_bind_4 345..396 CDD:278791 22/48 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.