DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Ad and Cpr51A

DIOPT Version :9

Sequence 1:NP_647875.1 Gene:Cpr64Ad / 38511 FlyBaseID:FBgn0035513 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_610968.1 Gene:Cpr51A / 36613 FlyBaseID:FBgn0033942 Length:144 Species:Drosophila melanogaster


Alignment Length:92 Identity:30/92 - (32%)
Similarity:41/92 - (44%) Gaps:13/92 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 VAAPLAAPVAAPIATEIVD---------AHPQYKFAYDVQDTLTGDSKTQEETRDGDVVRGSYSL 178
            ||..:|||.......|.::         .:.||.|...|.|.:.....::.|.|:|..||||||.
  Fly    12 VALCMAAPPRQESEAERIEREEYEKYQNENAQYSFNSSVDDKINDGQISRNEEREGGTVRGSYSY 76

  Fly   179 IEPDGSRRIVSYYADSINGFNAVVQKD 205
            .:....|| |.|.||. :|:.  |.||
  Fly    77 FDGFVKRR-VEYIADK-DGYR--VLKD 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AdNP_647875.1 Chitin_bind_4 146..198 CDD:306811 19/51 (37%)
Cpr51ANP_610968.1 Chitin_bind_4 44..94 CDD:278791 19/51 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.