DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Ad and Cpr50Ca

DIOPT Version :9

Sequence 1:NP_647875.1 Gene:Cpr64Ad / 38511 FlyBaseID:FBgn0035513 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_610899.1 Gene:Cpr50Ca / 36523 FlyBaseID:FBgn0033867 Length:815 Species:Drosophila melanogaster


Alignment Length:241 Identity:60/241 - (24%)
Similarity:83/241 - (34%) Gaps:47/241 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GAPLA---------AAPLGAPLAYSAPLGPAPYFAPAAYSAPLGYAAPLGYNAPLVAGPAPLVSK 78
            |.||.         |.|..:|......:.|.|......|.....|||.    ||.:|.|   :..
  Fly   387 GKPLVNYVKYINKPAEPAASPSPVQVHIQPVPVVEQLRYVYKPHYAAV----APTIAQP---IVV 444

  Fly    79 TYAAAPFAA------PFAAPVAPVAARLAAPVAAPLAAPVAPVAAPLAAPVAAPLAAPVAAPIAT 137
            ..|.||.||      .:.|.:||...: :..|..|...|..|  .||.|...|....|..|..:.
  Fly   445 QEAPAPTAAVEEVHHTYTAELAPPPTQ-SVEVVVPQFRPSKP--DPLLAEAPAIYGKPQEAYNSY 506

  Fly   138 EI-VDAHPQYKFAYDVQ-DTLTGDSKTQEETRDGDVVRGSYSLIEPDGSRRIVSYYADSINGFNA 200
            |: .:|.|..|..|..| |.:....|...|.:....:.|.    .||          |.|:|...
  Fly   507 ELQPEASPLIKIEYHAQPDGINEHYKQLPEFQQLSTLIGK----SPD----------DQIHGLTY 557

  Fly   201 VVQKDVPVAVAPVAPVLAKTVAAPVAPVV-----AAAPAPVFAKTL 241
            ::.|::...:......|........||::     .|:|||.. |||
  Fly   558 LLAKEMQAKLQRQGKQLVDRPQDSTAPILFHPGQGASPAPTL-KTL 602

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AdNP_647875.1 Chitin_bind_4 146..198 CDD:306811 11/52 (21%)
Cpr50CaNP_610899.1 Chitin_bind_4 751..803 CDD:278791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.