DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Ad and Cpr23B

DIOPT Version :9

Sequence 1:NP_647875.1 Gene:Cpr64Ad / 38511 FlyBaseID:FBgn0035513 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_608718.1 Gene:Cpr23B / 33480 FlyBaseID:FBgn0031467 Length:302 Species:Drosophila melanogaster


Alignment Length:196 Identity:66/196 - (33%)
Similarity:85/196 - (43%) Gaps:51/196 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 AAPFAAPFAAPVA---PVAARLAAPVAAPLAAPVAPVAAPLAAPVAAPLAAPV------------ 131
            |.|....:.||..   ...:|.|:..|:.|....|  :|..|..|..|...||            
  Fly    57 ATPDGYDYVAPARNQFTAGSRTASVQASNLLQNAA--SAANAESVLLPSPLPVLRHEQNSEVVSS 119

  Fly   132 --------------AAP-IATEIVDAHPQ--------YKFAYDVQDTLTGDSKTQEETRDGDVVR 173
                          :.| :.:.::..|.:        |.|.|.|.|..|||.|...|||||.|||
  Fly   120 TQQQQEQQTVQHQQSEPLVVSSVLRQHQEPEVFPPASYSFNYAVNDASTGDIKEHSETRDGYVVR 184

  Fly   174 GSYSLIEPDGSRRIVSYYADSINGFNAVVQKDVPVAVAPVAPVLAKTVAAPVAPVVAAAPAPVFA 238
            |.||||:|||.:|.|:|.||.::||||||.: ||.|:        |.|..|||.|  |.|.|..|
  Fly   185 GFYSLIDPDGYKRTVTYTADDVHGFNAVVNR-VPYAL--------KAVVVPVAQV--AQPTPFVA 238

  Fly   239 K 239
            :
  Fly   239 R 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AdNP_647875.1 Chitin_bind_4 146..198 CDD:306811 30/51 (59%)
Cpr23BNP_608718.1 Chitin_bind_4 157..209 CDD:278791 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.