DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Ac and CG34462

DIOPT Version :9

Sequence 1:NP_647874.1 Gene:Cpr64Ac / 38510 FlyBaseID:FBgn0035512 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001097548.1 Gene:CG34462 / 5740319 FlyBaseID:FBgn0085491 Length:312 Species:Drosophila melanogaster


Alignment Length:109 Identity:40/109 - (36%)
Similarity:56/109 - (51%) Gaps:13/109 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 YAAPKLLAAPAIS----YAAPAISYAPKVLAAPVAVAKVAVAEPYDPNPQYSFSYGVTDHHTGDS 106
            |||   |:.|..|    |..|.::  |:...|  .|....|.|||.|| .|||.|.:.|..|.:|
  Fly    20 YAA---LSNPLSSKIEVYNQPEVT--PEKERA--KVRNYFVHEPYGPN-TYSFGYEINDPQTQNS 76

  Fly   107 K-QQEETLVNGVVHGSYSLAEPDGTIRKVTYTADKVNGFNAVVE 149
            : ::|:..|||.:.|||..|.|||.|....|.|.:..|::|.::
  Fly    77 QFREEKRFVNGSIQGSYGYARPDGRIEVTKYMAKEDGGYSAQIQ 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AcNP_647874.1 Chitin_bind_4 92..144 CDD:395303 21/52 (40%)
CG34462NP_001097548.1 Chitin_bind_4 62..113 CDD:278791 21/50 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.