DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Ac and Ccp84Ag

DIOPT Version :10

Sequence 1:NP_647874.1 Gene:Cpr64Ac / 38510 FlyBaseID:FBgn0035512 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_649677.1 Gene:Ccp84Ag / 40819 FlyBaseID:FBgn0004777 Length:191 Species:Drosophila melanogaster


Alignment Length:144 Identity:61/144 - (42%)
Similarity:77/144 - (53%) Gaps:20/144 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LLAAPAISYAAPAISYAPKVLAAPVAVAKVAVAEPYDPNPQYSFSYGVTDHHTGDSKQQEETLVN 115
            :|.|..|:.|:..|..|    |||:|.  ||..|.|||:|||::.|.|.|..:||||.|.||...
  Fly     7 ILFAACIAVASAGIIPA----AAPLAA--VAQVEEYDPHPQYTYGYDVKDAISGDSKTQVETREG 65

  Fly   116 GVVHGSYSLAEPDGTIRKVTYTADKVNGFNAVVEKKGVAAVAIAKPALAVAAVPAITKIG----- 175
            .||.|.|||.:.||..|.|.||||.:|||||||.::.:.|...|.||..|||...:.:..     
  Fly    66 DVVQGQYSLNDADGYRRIVDYTADPINGFNAVVRREPLVAAVAAAPAAVVAAPAPVVRAAVAAPV 130

  Fly   176 ---------YASAP 180
                     ||:||
  Fly   131 VRAAPLTTTYAAAP 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AcNP_647874.1 Chitin_bind_4 92..144 CDD:459790 26/51 (51%)
Ccp84AgNP_649677.1 Chitin_bind_4 42..94 CDD:459790 26/51 (51%)

Return to query results.
Submit another query.