DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Ac and Cpr67B

DIOPT Version :9

Sequence 1:NP_647874.1 Gene:Cpr64Ac / 38510 FlyBaseID:FBgn0035512 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_648306.1 Gene:Cpr67B / 39081 FlyBaseID:FBgn0035985 Length:260 Species:Drosophila melanogaster


Alignment Length:137 Identity:41/137 - (29%)
Similarity:55/137 - (40%) Gaps:42/137 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 ISYAPKVLAAPVAVAK-----------------VAVAEPYDPNPQY-------SFSYGVTDHHTG 104
            |.||||....|:..|:                 ..|.|.||.: ||       .|:||..|.:.|
  Fly    45 IEYAPKTGENPLPEARNEKGEFVYMGRVIEHPEEYVEEHYDAH-QYHGQDGLGQFAYGYRDWNQG 108

  Fly   105 DSKQQEETLVNGVVHGSYSLAEPDGTIRKVTYTADKVNGFNAVVEKKGVAAVAIAKPA---LAVA 166
            .:::::||   |.|.|||...:|.|......|.||| .||:  ||..        :||   |...
  Fly   109 KNEKRDET---GKVTGSYKYVQPHGRDFVANYYADK-TGFH--VEDN--------RPAHLKLPAT 159

  Fly   167 AVPAITK 173
            ..||:.|
  Fly   160 KTPAVLK 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AcNP_647874.1 Chitin_bind_4 92..144 CDD:395303 19/58 (33%)
Cpr67BNP_648306.1 Chitin_bind_4 <111..144 CDD:278791 13/36 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.