DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Ac and Cpr66D

DIOPT Version :9

Sequence 1:NP_647874.1 Gene:Cpr64Ac / 38510 FlyBaseID:FBgn0035512 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_729400.1 Gene:Cpr66D / 38990 FlyBaseID:FBgn0052029 Length:270 Species:Drosophila melanogaster


Alignment Length:183 Identity:45/183 - (24%)
Similarity:66/183 - (36%) Gaps:59/183 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 APKLLAAPAISYAAPAI-----------SYAPKVLAAPVAVAKVAVA------------------ 83
            |.::.|.....|.||::           :|.|...|||....::..:                  
  Fly    77 AEQIRAQQQQGYVAPSVRDYQQYQPQQAAYRPPAQAAPQPPRRIQQSSYQAPSTSILGKGQHKLS 141

  Fly    84 -------EPY-DPNPQYSFSYGVTDHHTGDSKQQEETLVNGVVHGSYSLAEPDGTIRKVTYTADK 140
                   |.| |.|..|.|.:.|.|....:.:.::|.....|:.||||:.:.||.||.|.||||.
  Fly   142 LQQQNEEEEYDDQNSSYQFGFDVKDDEFTNYQNRKEIRDGSVIKGSYSVVDSDGFIRTVKYTADP 206

  Fly   141 VNGFNAVVEKKGVAAVAIAKPALAVAAVPA------ITKIG-------YASAP 180
            ..||.|.|         |.:|...|..:|.      :.:.|       |:|.|
  Fly   207 KEGFKAEV---------IREPTDIVVKIPTPPPPTQLLRAGGHKAQQEYSSGP 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AcNP_647874.1 Chitin_bind_4 92..144 CDD:395303 19/51 (37%)
Cpr66DNP_729400.1 Chitin_bind_4 158..210 CDD:278791 19/51 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.