DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Ac and Cpr64Ad

DIOPT Version :9

Sequence 1:NP_647874.1 Gene:Cpr64Ac / 38510 FlyBaseID:FBgn0035512 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_647875.1 Gene:Cpr64Ad / 38511 FlyBaseID:FBgn0035513 Length:247 Species:Drosophila melanogaster


Alignment Length:217 Identity:89/217 - (41%)
Similarity:106/217 - (48%) Gaps:47/217 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GLILSAVVAIPID-PYGLSAP--GLTYAAPKLLAAPAISYAAPKLLAAPAISYAAPAIS------ 65
            ||:.:.:.|.|:. |...|||  ...|.||...:|| :.||||....||.::..||.:|      
  Fly    20 GLVGAPLAAAPLGAPLAYSAPLGPAPYFAPAAYSAP-LGYAAPLGYNAPLVAGPAPLVSKTYAAA 83

  Fly    66 -----YAPKV------LAAPVA------VAKVA--------------VAEP-----YDPNPQYSF 94
                 :|..|      ||||||      ||.||              ||.|     .|.:|||.|
  Fly    84 PFAAPFAAPVAPVAARLAAPVAAPLAAPVAPVAAPLAAPVAAPLAAPVAAPIATEIVDAHPQYKF 148

  Fly    95 SYGVTDHHTGDSKQQEETLVNGVVHGSYSLAEPDGTIRKVTYTADKVNGFNAVVEKKGVAAVAIA 159
            :|.|.|..|||||.||||....||.|||||.||||:.|.|:|.||.:|||||||:|....|||..
  Fly   149 AYDVQDTLTGDSKTQEETRDGDVVRGSYSLIEPDGSRRIVSYYADSINGFNAVVQKDVPVAVAPV 213

  Fly   160 KPALA-VAAVPAITKIGYASAP 180
            .|.|| ..|.|....:..|.||
  Fly   214 APVLAKTVAAPVAPVVAAAPAP 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AcNP_647874.1 Chitin_bind_4 92..144 CDD:395303 31/51 (61%)
Cpr64AdNP_647875.1 Chitin_bind_4 146..198 CDD:306811 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.