DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Ac and Cpr64Ab

DIOPT Version :9

Sequence 1:NP_647874.1 Gene:Cpr64Ac / 38510 FlyBaseID:FBgn0035512 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_647873.2 Gene:Cpr64Ab / 38509 FlyBaseID:FBgn0035511 Length:120 Species:Drosophila melanogaster


Alignment Length:109 Identity:52/109 - (47%)
Similarity:67/109 - (61%) Gaps:5/109 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 AISYAPKVLAAPVAVAKVAVAEPYDPNPQYSFSYGVTDHHTGDSKQQEETLVNGVVHGSYSLAEP 127
            ||..|....|.||.   |.:....||:|||:|:|.|.|..|||||.|:|.....||.||||:.:.
  Fly    16 AIECALLPAAVPVG---VPLNTEVDPHPQYAFAYNVQDALTGDSKSQQEVRDGDVVKGSYSVVDA 77

  Fly   128 DGTIRKVTYTADKVNGFNAVVEKKGVAAVAIAKPALAVAAVPAI 171
            ||::|.|.||||.:|||||||: :|...|| |:|.:|..|.|.:
  Fly    78 DGSLRTVFYTADPINGFNAVVQ-RGPVPVA-ARPLVAPVAAPIL 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AcNP_647874.1 Chitin_bind_4 92..144 CDD:395303 27/51 (53%)
Cpr64AbNP_647873.2 Chitin_bind_4 42..94 CDD:278791 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.