DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Ac and Cpr64Aa

DIOPT Version :9

Sequence 1:NP_647874.1 Gene:Cpr64Ac / 38510 FlyBaseID:FBgn0035512 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_647872.1 Gene:Cpr64Aa / 38508 FlyBaseID:FBgn0035510 Length:192 Species:Drosophila melanogaster


Alignment Length:227 Identity:91/227 - (40%)
Similarity:107/227 - (47%) Gaps:75/227 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IAQTLFVLGLILSAVVAIPIDPYGLSAPGLTYAAPKLLAAPAI-SYAAPKLLAAPAISYAAPAIS 65
            :||.|.   |:|||:||:. ....:..||        ||.||. ||.|...:|||          
  Fly     1 MAQKLI---LVLSALVAVS-SAVVVPGPG--------LALPAYPSYPALAKVAAP---------- 43

  Fly    66 YAPKVLAAPVAVAKVAVAEPYDPNPQYSFSYGVTDHHTGDSKQQEETLVNGVVHGSYSLAEPDGT 130
                      .|||||..|||||||||:|||.|.|..|||.|.|:||....||.|:|||.|.|||
  Fly    44 ----------LVAKVAGPEPYDPNPQYTFSYDVHDGSTGDVKSQQETRSGDVVQGAYSLIEADGT 98

  Fly   131 IRKVTYTADKVNGFNAVVEKKG-----VAAVA--------------IAK---------------- 160
            .|.|.||||.|:||||||.::|     ||.||              :||                
  Fly    99 RRIVEYTADPVHGFNAVVRREGAVVKAVAPVAKVLAPAPLLHASPLVAKVPAYGPALAPAYPALA 163

  Fly   161 ----PALAVAAVPAITKIGYASAPGLSLGGYH 188
                ||||.|..||:.|:   :.|.||..|||
  Fly   164 HGYGPALAPAYGPALPKL---ALPALSPLGYH 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AcNP_647874.1 Chitin_bind_4 92..144 CDD:395303 30/51 (59%)
Cpr64AaNP_647872.1 Chitin_bind_4 60..112 CDD:278791 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.